Symbol	Name	Molecular function	Biological process	Cellular component	Description	LocusLink ID
PFA0005w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0010c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted for rifin by TMHMM2.0 at aa 289-311.	RIF
PFA0015c	var-like protein					
PFA0020w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted for rifin by TMHMM2.0 at aa 330-352	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFA0025c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR gene fragment (pseudogene) with similarity over 24 aa acids to the N terminus of VAR exon 1 of PFB1045w
PFA0030c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFA0035c	hypothetical protein, conserved in P. falciparum					
PFA0040w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	1 probable transmembrane helix predicted by TMHMM2.0 at aa 302-324
PFA0045c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted by TMHMM2.0 at aa 308-330	RIF
PFA0050c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 358.60, E-value 5.3e-105	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFA0055c	hypothetical protein, conserved in P. falciparum				3 probable transmembrane helices predicted by TMHMM2.0 at aa 4-22, 224-246 and 266-288	
PFA0060w	hypothetical protein, conserved in P. falciparum					
PFA0065w	Plasmdoium falciparum Maurer's Cleft 2 transmembrane domain protein 1.1, PfMC-2TM_1.1				PfMC-2TM_1.1	
PFA0070c	hypothetical protein pseudogene				pseudogene, stop codon at position 112 of 275. Similarity to a group of hypothetical proteins conserved on P. falciparum	hypothetical protein pseudogene
PFA0075w	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene fragment(exon 1) of 79 amino acids with stop codons at aa position 2	annotation change, aeb, 250402, gene model modified, coordinates chnaged from (78474..80126) to (79215..79452) on the basis of similarity evidence
PFA0080c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 568.50, E-value 4.3e-167
PFA0085c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR pseudogene of c. 450 amino acids with 19 stop codons
PFA0090c	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Similar to Plasmodium falciparum Stevor, Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.909, signal anchor probability 0.014) with cleavage site probability 0.559 between residues 19 and 20	stevor
PFA0095c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 424.60, E-value 1.9e-124	RIF
PFA0100c	hypothetical protein, conserved in P. falciparum					
PFA0105w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, E value 3.30e-17	stevor
PFA0110w	ring-infected erythrocyte surface antigen			host cell plasma membrane	Identical to published Plasmodium falciparum resA except amino acid positions between ~850 and ~1000	Pfam match to entry PF00226 DnaJ, DnaJ domain, score -4.70, E-value 0.095
PFA0115w	hypothetical protein			apicoplast	Conserved hypothetical protein, possibly belonging to cf-35 family. Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.943, signal anchor probability 0.000) with cleavage site probability 0.326 between residues 24 and 25	
PFA0120c	hydrolase, putative				Although there are a large number of weak hits to lysophospholipases from plant origin, it did not produce pfam hit to abhydrolase (alphabeta hydrolase) domain (PF00561) and so annotated as hypothetical protein	
PFA0125c	erythrocyte binding antigen-181				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0130c	Serine/Threonine protein kinase, FIKK family	protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0135w	Merozoite-associated tryptophan-rich antigen, putative				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.802, signal anchor probability 0.162) with cleavage site probability 0.393 between residues 24 and 25	
PFA0140c	hypothetical protein, conserved				asparagine-rich hypothetical protein	
PFA0145c	aspartyl-tRNA synthetase	aspartate-tRNA ligase activity	aspartyl-tRNA aminoacylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0150c	hypothetical protein, conserved				change of gene model through Bart	
PFA0155c	hypothetical protein, conserved					
PFA0160c	nucleoside transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0165c	hypothetical protein, conserved					
PFA0170c	zinc carboxy peptidase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0175w	hypothetical protein, conserved					
PFA0180w	hypothetical protein, conserved				Pfam match to entry PF00270 DEAD, DEAD/DEAH box helicase, score 28.60, E-value 4e-08; Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain, score 11.30, E-value 0.0081; Pfam hit to PF00271, Helicase conserved C-terminal domain	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.018, signal anchor probability 0.975) with cleavage site probability 0.005 between residues 25 and 26
PFA0185w	hypothetical protein, conserved				ProfileScan hit to PS50318, Lysine-rich region	Lysine-rich protein
PFA0190c	actin-related protein, ARP1	structural constituent of cytoskeleton		actin cytoskeleton	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0195w	hypothetical protein, conserved				Asparagine-rich; Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.251, signal anchor probability 0.742) with cleavage site probability 0.101 between residues 26 and 27	
PFA0200w	hypothetical protein, conserved			apicoplast	Pfam match to entry PF00090 tsp_1, Thrombospondin type 1 domain, score 33.40, E-value 5.1e-06; HMMSmart hit to SM00209, Thrombospondin type 1 repeats; ProfileScan hit to PS50092, Thrombospondin type I repeat (TSP1) profile	
PFA0205w	hypothetical protein					
PFA0210c	hypothetical protein, conserved				The top hit is WEAK hit to a transcription factor from Dictyostelium discoideum (SWALL:P90523 (EMBL:U68754); Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.996, signal anchor probability 0.000) with cleavage site probability 0.882 between residues 23 and 24	
PFA0215w	hypothetical protein, conserved					
PFA0220w	ubiquitin carboxyl-terminal hydrolase, putative	ubiquitin thiolesterase activity	ubiquitin-dependent protein catabolic process	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0225w	LytB protein		isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0230c	hypthetical protein, conserved					
PFA0235w	hypthetical protein, conserved				Second exon uncertain	
PFA0240w	novel putative transporter, PfNPT				A member of a proposed novel family of transporters,PfNPT(PMID:15774027); which also comprises PFA0245w,PFC0530w,PFI0720w and PF11_0310;Structurally there are 12 transmembrane domains, organised into two closely spaced groups of six separated by a hydrophilic loop; Contains a MFS-specific motif between transmembrane domains 2 and 3 and between 8 and 9, which is consistent with the hypothesis that they are distantly related to the Major facilitator Superfamily	<b>attribution</b>:
PFA0245w	novel putative transporter, PfNPT				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.008, signal anchor probability 0.837) with cleavage site probability 0.003 between residues 52 and 53	<b>attribution</b>:
PFA0250w	hypothetical protein, conserved				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.008, signal anchor probability 0.837) with cleavage site probability 0.003 between residues 52 and 53	
PFA0255c	hypothetical protein, conserved					
PFA0260c	hypothetical protein,c onserved				HMMSmart match to entry SM0673; CARP; Domain in CAPS (Clyclase associated proteins), E-value 5.7e-07	Similar to C-terminus region of adenyl cyclase-related proteins from mouse and human, similarity starts about 320 amino acid downstrem of the start codon in these adenyl cyclase-related proteins; it is not annotated as a putative adenyl cyclase-related protein despite the database hits because this protein is much smaller than other adenyl cyclase-related proteins and the N-terminal conserved residues of other adenyl cyclase-related proteins are absent in this protein
PFA0265c	hypothetical protein, conserved				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 1.000, signal anchor probability 0.000) with cleavage site probability 0.927 between residues 20 and 21	
PFA0270c	hypothetical protein, conserved					
PFA0275c	hypothetical protein				ScanRegExp hit to PS00017, ATP/GTP-binding site motif A (P-loop)	
PFA0280w	asparagine-rich antigen Pfa35-2				Does not match exactly to the previously submitted SWALL:Q03628 (EMBL:M59474) Plasmodium falciparum Pfa35-2 sequence fragment (PMID:1922204)	
PFA0285c	hypothetical protein, conserved					
PFA0290w	DNA binding protein, putative	DNA binding			fasta; TR:O96144 (EMBL:AE001381); Plasmodium falciparum; protein with egl-like 3'-5' exonucl. domain; pfb0215C; length 416 aa; id=26.16%; ungapped id=29.61%; E()=3.2e-05; ; 386 aa overlap; query 58-408 aa; subject 6-381 aa. Putative egl-like 3'-5' exonuclease proteiwith similarity to pfb0215C. Pfam hit to PF01612, 3'-5' exonuclease; HMMSmart hit to SM00474, 3'-5' exonuclease	<b>attribution</b>:
PFA0295c	hypothetical protein, conserved				first exon uncertain	
PFA0300c	vacuolar ATP synthase, putative	hydrogen ion transporting ATPase activity, rotational mechanism	ATP synthesis coupled proton transport	proton-transporting ATP synthase complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0305c	hypothetical protein, conserved					
PFA0310c	calcium-transporting ATPase	calcium-transporting ATPase activity	calcium ion transport		Pfam match to entry PF00689 Cation_ATPase_C, Cation transporting ATPase, C-terminus, score 281.80, E-value 9e-81; Pfam match to entry PF00702 Hydrolase, haloacid dehalogenase-like hydrolase, score 59.80, E-value 5.9e-14; Pfam match to entry PF00690 Cation_ATPase_N, Cation transporter/ATPase, N-terminus, score 73.10, E-value 5.7e-18	<b>attribution</b>:
PFA0315w	hypothetical protein, conserved					
PFA0320w	hypothetical protein, conserved					
PFA0325w	hypothetical protein					
PFA0330w	pfAARP2 protein			plasma membrane	The published (Pubmed ID:97391121) Plasmodium falciparum AARP2 protein sequence (SWALL:Q94649 (EMBL:Y08924)) differs from this model only at the start site and at the internal repeat sites. The sequence was double checked and verified	ScanRegExp hit to PS00017, ATP/GTP-binding site motif A (P-loop)
PFA0335w	Rab5c, GTPase	GTPase activity	small GTPase mediated signal transduction		Pfam match to entry PF00071 ras, Ras family, score 238.00, E-value 1.3e-67; smart:SM00175;Rab subfamily of small GTPases;codon 29-206; ScanRegExp hit to PS00017, ATP/GTP-binding site motif A (P-loop)	Rab5c
PFA0340w	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0345w	centrin, putative	calcium ion binding	mitosis	centrosome	Pfam match to entry PF00036 efhand, EF hand, score 25.70, E-value 0.0011; HMMSmart hit to SM00054, EF-hand, calcium binding motif; ProfileScan hit to PS50222, Ca-binding EF-hand motif; ScanRegExp hit to PS00018, EF-hand calcium-binding domain	Similar to centrins from several organisms
PFA0350c	hypothetical protein, conserved					
PFA0350w	hypothetical protein, conserved				It is possible that this acts as transcriptional regulator, Blastp results suggest that there is weak domain homology to CCR4 type transcriptional regulators of N. crassa, Candida albicans and also to a similar transcriptional regulator protein from Schizosaccharomyces pombe	
PFA0360c	hypothetical protein, conserved in P. falciparum				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.915, signal anchor probability 0.022) with cleavage site probability 0.654 between residues 22 and 23	
PFA0365c	hypothetical protein, conserved in P. falciparum				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.915, signal anchor probability 0.022) with cleavage site probability 0.654 between residues 22 and 23	
PFA0370w	hypothetical protein, conserved					
PFA0375c	lipid/sterol:H+ symporter				Pfam match to entry PF02460 Patched, Patched family, score -28.20, E-value 3e-16	Putative patched family protein; Signal anchor predicted by SignalP 2.0 HMM between residues 53 and 54. Pfam hit to PF02460, Patched family
PFA0380w	serine/threonine protein kinase, putative	ATP binding, protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0385w	hypothetical protein, conserved			apicoplast	contains potential signal peptide and 4 potential transmembrane domains	
PFA0390w	DNA repair exonuclease, putative	exonuclease activity	DNA repair		Pfam match to entry PF02549 DNA_repair, DNA repair exonuclease, score 32.30, E-value 5.6e-18	Alternative splice acceptor site exits for exon2
PFA0400c	beta3 proteasome subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0405w	hypothetical protein, conserved					
PFA0410w	hypothetical protein, conserved				asparagine-rich	
PFA0415c	mitochondrial carrier protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0420w	hypothetical protein, conserved				Very weak hit (7.20e-01) to ELM2 domain	Pfam match to entry PF01448 ELM2, ELM2 domain, score 8.10, E-value 0.72;ProfileScan hit to PS50313, Glutamic acid-rich region
PFA0425c	hypothetical protein, conserved					
PFA0430c	hypothetical protein, conserved				contains possible signal sequence. Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.973, signal anchor probability 0.000) with cleavage site probability 0.962 between residues 19 and 20	
PFA0435w	hypothetical protein, conserved				Although most of the fasta hits are ATP synthase, the e-value is not significant, also HMMSmart does not pick hits to any domain	
PFA0440w	hypothetical protein, conserved					
PFA0445w	hypothetical protein, conserved				Obsolete product name: hypothetical protein with LCCL domain	HMMSmart hit to SM0603, LCCL domain, 4.49e-06; ProfileScan hit to PS50820, LCCL domain profile
PFA0450c	mRNA cleavage factor-like protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0455c	integral membrane protein, GNS1/SUR4 family, putative			plasma membrane	Integral membrane protein, similar to Mus musculus cold inducible glycoprotein 30	Pfam match to entry PF01151 GNS1_SUR4, GNS1/SUR4 family, score 32.80, E-value 1.4e-12
PFA0460c	tubulin-specific chaperone a, putative	unfolded protein binding	protein complex assembly, protein folding, tubulin folding		HMMpfam hit to tubulin binding cofactor A (PF02970); e-value:2.00e-0	Similar to Mus musculus tubulin-specific chaperone
PFA0465c	N-terminal acetyltransferase, putative	N-acetyltransferase activity	N-terminal protein amino acid acetylation		Putative acetyltransferase, similar to Drosophila melanogaster Cg14222 protein	Pfam match to entry PF00583 Acetyltransf, Acetyltransferase (GNAT) family, score 43.80, E-value 3.8e-09
PFA0470c	cold-shock protein, putative	double-stranded DNA binding	intracellular signaling cascade, regulation of transcription, DNA-dependent		Similar to cold-shock domain protein	Pfam match to entry PF00313 CSD, 'Cold-shock' DNA-binding domain, score 44.70, E-value 4.1e-11; HMMSmart hit to SM00357, Cold shock protein domain;ScanRegExp hit to PS00352, 'Cold-shock' domain signature Confirmed by InterPro eMOTIF pattern match
PFA0475c	hypothetical protein, conserved				ProfileScan hit to PS50318, Lysine-rich region	Obsolete product name: hypothetical protein with lysine-rich domain
PFA0480w	phenylalanyl-tRNA synthetase beta chain, putative	phenylalanine-tRNA ligase activity	phenylalanyl-tRNA aminoacylation	phenylalanine-tRNA ligase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0485w	dolichol kinase			apicoplast	PFAM hit to DUF56 family PF01879, 4.2e-02	<b>attribution</b>:
PFA0490w	hypothetical protein, conserved				contains signal sequence. Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.362, signal anchor probability 0.635) with cleavage site probability 0.311 between residues 29 and 30	
PFA0495c	selenocysteine-specific elongation factor selB homologue, putative	translation elongation factor activity	translational elongation		Putative selenocysteine-specific elongation factor Tu family protein; the similarity exists in the N-terminal half of the protein	Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu family, score 53.20, E-value 7.9e-14; ScanRegExp hit to PS00017, ATP/GTP-binding site motif A (P-loop) elongation factor selB homologue
PFA0500w	human hepatopoietin-like protein, putative		cell proliferation		fasta; TR:AAD17328 (EMBL:AF124604); Homo sapiens; hepatopoietin hpo2; ; length 125 aa; id=38.54%; ungapped id=38.54%; E()=1.9e-11; ; 96 aa overlap; query 37-132 aa; subject 16-111 aa. Putative hepatopoietin-like protein, belonging to ERV1/ALR family	
PFA0505c	DNA-directed RNA polymerase 2 subunit, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0510w	hypothetical protein, conserved				Pfam match to entry PF00439 bromodomain, Bromodomain, score 37.10, E-value 2.3e-09; HMMSmart hit to SM00297, bromo domain	Plasmodium falciparum hypothetical protein with bromodomain
PFA0515w	phosphatidylinositol-4-phosphate 5-kinase, putative	1-phosphatidylinositol-4-phosphate 5-kinase activity	phosphoinositide-mediated signaling		Possible phosphatidylinositol-4-phosphate 5-kinase	Pfam hit to PF01504,Phosphatidylinositol-4-phosphate 5-Kinase; Pfam hit to PF00036, EF hand;HMMSmart hit to SM00330, Phosphatidylinositol phosphate kinases; ScanRegExp hit to PS00018, EF-hand calcium-binding domain; ScanRegExp hit to PS00038, Myc-type,'helix-loop-helix' dimerisation domain signature
PFA0520c	chromatin assembly factor 1 protein WD40 domain, putative	histone binding, unfolded protein binding	nucleosome assembly	chromatin assembly complex	Pfam match to entry PF00400 WD40, WD domain, G-beta repeat, score 23.80, E-value 0.0042;HMMSmart hit to SM00320, WD40 repeats	putative chromatin assembly factor 1 protein with 6 WD40 repeat domains
PFA0525w	transcription initiation factor TFIIB, putative	RNA polymerase II transcription factor activity	transcription initiation from RNA polymerase II promoter	transcription factor complex	Pfam hit to PF00097, Zinc finger, C3HC4 type (RING finger), Pfam hit to PF00382, Transcription factor TFIIB repeat	<b>attribution</b>:
PFA0530c	adenylate kinase, putative					
PFA0535c	kinesin, putative	microtubule motor activity	microtubule-based movement	kinesin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0540c	hypothetical protein, conserved					
PFA0545c	replication factor c protein, putative		DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFA0550w	hypothetical protein, conserved				TMMHMM2.0 predicts three putative transmembrane domains near the N-terminus	
PFA0555c	UMP-CMP kinase, putative	uridine kinase activity	pyrimidine nucleotide biosynthetic process	apicoplast	Putative UMP-CMP kinase, alternative start site could be methionine approximately 100 amino acids downstream; similar to Cryptosporidium parvum ump kinase umpK TR:O96498 (EMBL:AF067966)	<b>attribution</b>:
PFA0560c	hypothetical protein, conserved					
PFA0565c	hypothetical protein, conserved				gene finder predicts a larger protein with weak similarity to a haem lyase protein but the exon sequence is not convincing with a stretch of IYIYIYs	
PFA0570w	hypothetical protein, conserved				splicing pattern uncertain, possible exon at 146563..146649	
PFA0575c	hypothetical protein, conserved					
PFA0580c	TatD-like deoxyribonuclease, putative	deoxyribonuclease activity	DNA metabolic process	apicoplast	Pfam match to entry PF01026 TatD_DNase, TatD related DNase, score 117.30, E-value 2.9e-31	Originally annotated as Plasmodium falciparum; conserved hypothetical protein but pfam match and other evidences suggest that it is a putative deoxyribonuclease; earlier start site possible to make a 412 aa protein
PFA0585w	hypothetical protein, conserved				contains possible signal sequence. Signal peptide predicted SignalP 2.0 HMM (Signal peptide probabilty 0.640, signal anchor probability 0.357) with cleavage site probability 0.504 between residues 27 and 28. ScanRegExp hit to PS00867, Carbamoyl-phosphate synthase subdomain signature 2	
PFA0590w	ABC transporter(CT family), PfMRP	ATPase activity, coupled to transmembrane movement of substances	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL1_18s	18s rRNA A-type				18s rRNA exppressed in asexual stage parasites	
MAL1_ITS1	ITS1 A-type				ribosomal operon internal transcribed spacer 1 expressed in asexual stage parasites	
MAL1_5.8s	5.8s rRNA				hit to vivax A-type 5.8S ribosomal percent id: 88.00 none	5.8S ribosomal exppressed in asexual stage parasites
MAL1_ITS2	ITS2 A-type				ribosomal operon internal transcribed spacer 2 expressed in asexual stage parasites	
MAL1_28s	28s rRNA (A-type)				28s rRNA expressed during asexual development	
PFA0610c	hypothetical protein, conserved in P. falciparum			apicoplast	Conserved hypothetical membrane protein, Similarity to P. falciparum chromosome 2 predicted integral membrane protein (PFB0110W). Signal anchor predicted SignalP 2.0 HMM (Signal peptide probabilty 0.145, signal anchor probability 0.851) with cleavage site probability 0.048 between residues 25 and 26	
PFA0615w	hypothetical protein				Plasmodium falciparum hypothetical protein. Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.624, signal anchor probability 0.000) with cleavage site probability 0.200 between residues 28 and 29	
PFA0620c	glutamic acid-rich protein (garp)				P. falciparum glutamic acid-rich protein; Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.869, signal anchor probability 0.050) with cleavage site probability 0.208 between residues 23 and 24	
PFA0625w	surface-associated interspersed gene, (SURFIN)				3D7surf1.1	moderately similar to SWALL:Q9N894 (EMBL:AL360354) Plasmodium vivax Pvstp1 protein (826 aa)
PFA0630c	hypothetical protein				splicing: 2 exons predicted but alternative(s) exist(s)	
PFA0635c	hypothetical protein				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.009, signal anchor probability 0.990) with cleavage site probability 0.007 between residues 29 and 30	
PFA0640c	hypothetical protein					
PFA0645c	hypothetical protein					
PFA0650w	surface-associated interspersed gene pseudogene, (SURFIN) pseudogene				3D7surf1.2	Formerly PFA0650w and PFA0655w. These have been joined to form the present model(PFA0650w). This reflects the domain organisation observed in other members of the surfin gene family (PMID:15939796); RT-PCR data, kindly presented by Dr Osamu Kaneko, has confirmed the splicing at the first exon and the presence of an in-frame stop codon in exon2.
PFA0660w	protein with DNAJ domain, dnj1/sis1 family	unfolded protein binding	response to heat		Pfam match to entry PF00226 DnaJ, DnaJ domain, score 126.30, E-value 5.5e-34; Pfam match to entry PF01556 DnaJ_C, DnaJ C terminal region, score 42.90, E-value 7e-09; HMMSmart hit to SM00271, DnaJ molecular chaperone homology domain; ScanRegExp hit to PS00636, Nt-dnaJ domain signature, confirmed by InterPro eMOTIF pattern match;eProfileScan hit to PS50076, dnaJ domain profile	Similar to Plasmodium falciparum protein with DNAJ domain and also to heat-shock proteins
PFA0665w	hypothetical protein, conserved in P. falciparum				hypothetical protein, weakly related to erythrocyte binding proteins from P. falciparum; Blastp results indicate this protein is similar to erythrocyte binding proteins whereas fasta results show similarities to Fibrinogen binding protein / clumping factor from bacterial origin. Because of lack of conclusive evidence it is annotated as a hypothetical protein; possibilities exist for more than 1 protein coded by these exons rather than one large protein	
PFA0670c	hypothetical protein, conserved in P. falciparum				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.687, signal anchor probability 0.232) with cleavage site probability 0.431 between residues 24 and 25	
PFA0675w	P. falciparum RESA-like protein with DnaJ domain				Also moderately similar to P. falciparum mature parasite-infected erythrocyte surface antigen (mesa); The first exon may extend 12 more amino acids as a potential splice-donor site exits; Contains repeats, C-terminal domain virtually identical to SWALL:O97462 (EMBL:AL034559); Plasmodium falciparum; pfc1075w protein	change of gene model through Bart
PFA0680c	Plasmodium falcioparum maurer's cleft 2 transmembrane domain protein 1.2, PfMC-2TM_1.2				PfMC-2TM_1.2	
PFA0685c	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 1.1, PfMC-2TM_1.1			apicoplast	PfMC-2TM_1.1	Similar to Plasmodium falciparum pfc1085c protein pfc1085c or pfb0990C TR:O97474 (EMBL:AL034559) except in the internal repeat region. Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.712, signal anchor probability 0.000) with cleavage site probability 0.405 between residues 23 and 24
PFA0690w	hypothetical protein conserved in P. falciparum, pseudogene				Contains 7 stop codons within the proposed ORF	Possible pseudogene; Similar to TR:O97308 (EMBL:AL034559); Plasmodium falciparum; Pfc1090W protein family but splicing not possible to obtain full length protein; alternative gene model possibilities exists with 2 separate proteins being coded by this region of DNA; fasta; TR:O97308 (EMBL:AL034559); Plasmodium falciparum; Pfc1090W protein; pfc1090W; length 309 aa; id=53.43%; ungapped id=58.6%; E()=1.1e-21; ; 204 aa overlap; query 4-191 aa; subject 108-309 aa. hypothetical protein; could be a part of the preceding ORF to form a full protein similar to Pfc1090w but splicing is not possible to obtain right protein; could be a pseudogene; Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.115, signal anchor probability 0.839) with cleavage site probability 0.060 between residues 25 and 26
PFA0695c	erythrocyte membrane protein 1 (PfEMP1)-like, pseudogene				Var-like pseudogene, 20 stop codons present; similarity to exon 2; fasta; TR:Q9NFB4 (EMBL:AL031747); Plasmodium falciparum; VAR-like protein, Mal1p4.03; mal1p4.03; length 1327 aa; id=47.05%; ungapped id=53.78%; E()=3.3e-16; ; 136 aa overlap; query 4-131 aa; subject 1075-1201 aa	VAR-like pseudogene
PFA0700c	hypothetical protein, conserved in P. falciparum			apicoplast	Predicted secreted protein family, conserved in P. falciparum, with 1 predicted transmembrane domain	
PFA0705c	stevor pseudogene putative				annotation change, aeb, 250205, gene model modified, coordinates changed from (562196..563256) to (562299..563256)	putative STEVOR pseudogene; similarity to Plasmodium falciparum stevor 3d73-2; length 296 aa; id=79.03%; ungapped id=79.03%; E()=1.3e-16; ; 62 aa overlap; query 1-62 aa; subject 1-62 aa
PFA0710c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 427.60, E-value 2.5e-125
PFA0715c	hypothetical protein, conserved in P. falciparum			apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.011, signal anchor probability 0.667) with cleavage site probability 0.008 between residues 24 and 25	
PFA0720w	hypothetical protein				hypothetical protein	
PFA0725w	surface-associated interspersed gene, (SURFIN)				hypothetical protein, possibly conserved in P. falciparum, weakly similar to Plasmodium vivax Pvstp1 protein	3D7surf1.3
PFA0735w	hypothetical protein, conserved in P.falciparum				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.006, signal anchor probability 0.985) with cleavage site probability 0.002 between residues 29 and 30	
PFA0740w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 516.40, E-value 1.7e-151	RIF
PFA0745w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Similar to Plasmodium falciparum rifins
PFA0750w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)	Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 384.80, E-value 1e-112
PFA0755w	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR-like pseudogene, similarity to exon 1, 17 stop codons present
PFA0760w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Similar to Plasmodium falciparum Rifins
PFA0765c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	Pfam match to entry PF03011 PFEMP1, score 167.00, E-value 3.2e-46
PFL0005w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0010c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	HMMPfam hit to PF02009, Rifin/stevor family, score 2.7e-177	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFL0015c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFL0020w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0025c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	HMMPfam hit to PF02009, Rifin/stevor family, score 2.5e-193
PFL0030c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0035c	acetyl-CoA synthesase, PfACS7	molecular_function	biological_process	apicoplast	HMMPfam hit to PF00501, AMP-binding enzyme, score 8.7e-46	PfACS7
PFL0040c	protein kinase, FIKK family				HMMPfam hit to PF00069, Protein kinase domain, score 4.1e-05	<b>attribution</b>:
PFL0045c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0050c	hypothetical protein				hypothetical protein, conserved in P. falciparum	
PFL0055c	protein with DNAJ domain (resa-like), putative	molecular_function	biological_process	membrane	HMMSmart hit to SM00271, DNAJ molecular chaperone homology domain, score 7.1e-20	
PFL0060w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	match to EST T02526.1	
PFL0065w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0070c	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	hypothetical protein	
PFL0075w	XPA binding protein 1, putative	ATP binding	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0080c	serine/threonine-protein kinase, Pfnek-3	ATP binding, protein serine/threonine kinase activity	protein amino acid phosphorylation	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0085c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0090c	hypothetical protein, conserved				hypothetical protein	
PFL0095c	hypothetical protein, conserved				hypothetical protein	
PFL0100c	ATP dependent RNA helicase, putative	ATP binding, ATP-dependent RNA helicase activity	RNA metabolic process	cellular_component	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 3.7e-11	
PFL0105w	hypothetical protein, conserved				match to ESTs BM274431.1, BM273988.1	
PFL0110c	mitochondrial phosphate carrier protein, PfmpC	binding	transport	membrane, mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0115w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to ESTs BM274045.1, AU087052.1	
PFL0120c	cyclophilin, putative	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding	cellular_component	HMMPfam hit to PF00160, Cyclophilin type peptidyl-prolyl cis-trans isomerase, score 1.4e-69	
PFL0125c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI814308.1	
PFL0130c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion	Similar to putative protein (Arabidopsis thaliana) TR:Q9LTX7 (EMBL:AB024032) (1080 aa) fasta scores: E(): 9e-24, 28.772% id in 855 aa, and to CG11847 gene product (Drosophila melanogaster) (972 aa) AAF56406.1 fasta scores: E(): 2.4e-24, 27.595% id in 819 aa	
PFL0135w	hypothetical protein, conserved				hypothetical protein	
PFL0140w	hypothetical protein, conserved				hypothetical protein	
PFL0145c	high mobility group protein	chromatin binding	regulation of transcription, DNA-dependent	chromatin, nucleus	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0150w	origin recognition complex 1 protein	DNA replication origin binding	DNA replication initiation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0155c	hypothetical protein, conserved in P. falciparum				match to EST BM276217.1	
PFL0160w	signalrecognition particle subunit, SRP14				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0165c	hypothetical protein, conserved				hypothetical protein	
PFL0170w	transporter	molecular_function	biological_process	membrane	match to EST N97983.1	<b>attribution</b>:
PFL0175c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMPfam hit to PF01300, yrdC domain, score 2.6e-11	
PFL0180w	cytochrome c1 heme lyase, putative	holocytochrome-c synthase activity	electron transport	mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0185c	nucleosome assembly protein 1, putative	DNA binding	nucleosome assembly	nucleus	HMMPfam hit to PF00956, Nucleosome assembly protein (NAP), score 1.5e-53	
PFL0190w	ubiquitin-conjugating enzyme e2, putative	ubiquitin conjugating enzyme activity	protein modification, ubiquitin cycle	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0195w	hypothetical protein, conserved				hypothetical protein	
PFL0200c	hypothetical protein, conserved				hypothetical protein	
PFL0205w	hypothetical protein, conserved				hypothetical protein	
PFL0210c	eukaryotic initiation factor 5a, putative	translation initiation factor activity	translational initiation	cellular_component	HMMPfam hit to PF01287, Eukaryotic initiation factor 5A hypusine, DNA-binding OB fold, score 3.2e-24	<b>attribution</b>:
PFL0215c	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	hypothetical protein	
PFL0220c	hypothetical protein, conserved	molecular_function	biological_process	membrane	Alternative exon 6 at complement(209556..209618); supported by EST BM275417.1	
PFL0225c	hypothetical protein, conserved				hypothetical protein	
PFL0230w	hypothetical protein				hypothetical protein; potentially cytidine/deoxycytidylate deaminase	
PFL0235w	hypothetical protein, conserved					
PFL0240w	hypothetical protein	molecular_function	biological_process	membrane	hypothetical protein	
PFL0245w	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL0250w	hypothetical protein, conserved	molecular_function	biological_process	membrane	Similar to Plasmodium falciparum Pfatpase3 pfatpase3 TR:Q9U0N7 (EMBL:X65740) (1903 aa) fasta scores: E(): 1.1e-11, 25.845% id in 414 aa	
PFL0255c	uga suppressor tRNA-associated antigenic protein, putative				Similar to Homo sapiens uga suppressor trna-associated antigenic protein trnp48 TR:Q9UGM9 (EMBL:AJ238617) (441 aa) fasta scores: E(): 2.4e-45, 35.880% id in 432 aa, and to Homo sapiens sla/lp autoantigen TR:Q9NXZ5 (EMBL:AJ277541) (474 aa) fasta scores: E(): 6.1e-47, 34.632% id in 462 aa	
PFL0260c	hypothetical protein, conserved				hypothetical protein	
PFL0265w	hypothetical protein, conserved				hypothetical protein	
PFL0270c	hypothetical protein, conserved				match to EST BI815080.1	
PFL0275w	hypothetical protein, conserved				HMMPfam hit to PF00097, Zinc finger, C3HC4 type (RING finger), score 9.8e-13	
PFL0280c	hypothetical protein, conserved				match to ESTs AU087291.1, BI815594.1	
PFL0285w	glyoxalase II family protein, putative	hydroxyacylglutathione hydrolase activity	methylglyoxal metabolic process	mitochondrial matrix, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0290w	hypothetical protein, conserved				match to ESTs N97875.1, BI814869.1	
PFL0295c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	Similar to Mus musculus 4632413c14riK protein 4632413c14riK TR:Q9D675 (EMBL:AK014571) (631 aa) fasta scores: E(): 2.4e-30, 35.337% id in 416 aa	
PFL0300c	phosphoesterase, putative				match to EST BI814004.1	
PFL0305c	hypothetical protein, conserved				Similar to Schizosaccharomyces pombe hypothetical 45.8 kDa protein c30d10.03c in chromosome ii spbc30d10.03C TR:O14349 (EMBL:Z97992) (405 aa) fasta scores: E(): 1.4e-33, 35.613% id in 351 aa	
PFL0310c	eukaryotictranslation initiation factor 3 subunit 8, putative	translation initiation factor activity	regulation of translational initiation	eukaryotic translation initiation factor 3 complex	HMMPfam hit to PF01399, PCI domain, score 1.6e-07	<b>attribution</b>:
PFL0315c	hypothetical protein, conserved				hypothetical protein	
PFL0320w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0325w	hypothetical protein, conserved				hypothetical protein	
PFL0330c	DNA-directed RNA polymerase III subunit, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase III promoter	DNA-directed RNA polymerase III complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0335c	eukaryotictranslation initiation factor 5, putative	translation initiation factor activity	regulation of translational initiation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0340w	hypothetical protein, conserved				hypothetical protein	
PFL0345w	hypothetical protein, conserved				hypothetical protein	
PFL0350c	hypothetical protein, conserved				Similar to Plasmodium falciparum Pfc0760C protein pfc0760C TR:O77384 (EMBL:Z98551) (3394 aa) fasta scores: E(): 1.6e-24, 23.341% id in 2772 aa	
PFL0355c	hypothetical protein, conserved				hypothetical protein	
PFL0360c	hypothetical protein	molecular_function	biological_process	membrane	match to EST AU087505.1	
PFL0365c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL0370w	hypothetical protein, conserved				match to EST BM274605.1	
PFL0375w	hypothetical protein	molecular_function	biological_process	apicoplast	hypothetical protein, conserved	
PFL0380c	tRNA delta(2)-isopentenylpyrophosphate transferase, putative	ATP binding, tRNA isopentenyltransferase activity	tRNA processing	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0385c	blood stage antigen 41-3 precursor				Identical to Plasmodium falciparum blood stage antigen 41-3 precursor TR:Q99019 (EMBL:M59961) (375 aa) fasta scores: E(): 2.8e-118, 100.000% id in 375 aa	
PFL0390c	hypothetical protein, conserved				hypothetical protein	
PFL0395c	hypothetical protein, conserved				hypothetical protein	
PFL0400w	50S ribosomal protein L29, putative	molecular_function	biological_process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0405w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0410w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BM274905.1	
PFL0415w	acyl carrier protein, mitochondrial precursor, putative	acyl carrier activity	fatty acid biosynthetic process	mitochondrion	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 4.4e-05	
PFL0420w	amino acid transporter	amine transporter activity	amino acid transport	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0425c	hypothetical protein, conserved				hypothetical protein	
PFL0430w	tim10 homologue, putative	protein translocase activity	protein targeting to mitochondrion, protein transport	mitochondrial inner membrane presequence translocase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0435w	hypothetical protein, conserved				hypothetical protein	
PFL0440c	hypothetical protein, conserved	molecular_function	biological_process	membrane	Similar to Plasmodium falciparum asparagine-rich protein TR:CAA70302 (EMBL:Y09082) (541 aa) fasta scores: E(): 1.1e-20, 28.383% id in 532 aa	
PFL0445w	hypothetical protein, conserved				match to ESTs AU086820.1, AU087608.1, AU087910.1	
PFL0450c	hypothetical protein, conserved				hypothetical protein	
PFL0455c	hypothetical protein, conserved				hypothetical protein	
PFL0460w	u6 snRNA-associated Sm-like protein, putative	RNA splicing factor activity, transesterification mechanism	nuclear mRNA splicing, via spliceosome	nucleus, small nucleolar ribonucleoprotein complex, spliceosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0465c	Zinc finger transcription factor (krox1)	DNA binding	regulation of transcription, DNA-dependent	nucleus	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0470w	hypothetical protein, conserved				HMMPfam hit to PF00400, WD domain, G-beta repeat, score 3.2e-07	
PFL0475w	3',5'-cyclic-nucleotide phosphodiesterase, putative	3',5'-cyclic-nucleotide phosphodiesterase activity	signal transduction	membrane	HMMPfam hit to PF00233, 3'5'-cyclic nucleotide phosphodiesterase, score 3.8e-58	<b>attribution</b>:
PFL0480w	porphobilinogen deaminase, putative	hydroxymethylbilane synthase activity	porphyrin biosynthetic process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0485w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0490c	hypothetical protein, conserved				hypothetical protein	
PFL0495c	ABC transporter, (TAP family)	ATP binding, ATPase activity, coupled to transmembrane movement of substances	transport	membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0500w	50S ribosomal protein L1, putative	structural constituent of ribosome	translation	apicoplast, cytosolic large ribosomal subunit (sensu the Bacteria research community), membrane, mitochondrion	HMMPfam hit to PF00687, Ribosomal protein L1p/L10e family, score 5.1e-11	<b>attribution</b>:
PFL0505c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0510c	hypothetical protein, conserved				match to ESTs BM274857.1, BM275247.1, BM276028.1, BM275710.1	
PFL0515w	hypothetical protein, conserved				hypothetical protein	
PFL0520c	hypothetical protein, conserved				match to EST BI814878.1	
PFL0525w	hypothetical protein, conserved				hypothetical protein	
PFL0530c	hypothetical protein, conserved				match to EST BM275832.1	
PFL0535c	hypothetical protein, conserved				hypothetical protein	
PFL0540w	mannosyltransferase, putative	mannosyltransferase activity	protein amino acid glycosylation	endoplasmic reticulum, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0545w	kinesin-related protein, putative	ATP binding, ATPase activity, microtubule motor activity	microtubule-based movement	kinesin complex	HMMPfam hit to PF00225, Kinesin motor domain, score 5.4e-72	<b>attribution</b>:
PFL0550w	hypothetical protein, conserved				hypothetical protein	
PFL0555c	hypothetical protein, conserved				match to EST BI936026.1	
PFL0560c	minichromosome maintenance protein, putative	ATP binding, ATP-dependent DNA helicase activity, DNA-dependent ATPase activity	DNA replication initiation, DNA strand elongation during DNA replication	pre-replicative complex	HMMPfam hit to PF00493, MCM2/3/5 family, score 2.6e-53	
PFL0565w	heat shock protein DNAJ homologue Pfj4	unfolded protein binding	response to heat, response to unfolded protein	cellular_component	HMMPfam hit to PF00226, DnaJ domain, score 2e-39	
PFL0570c	hypothetical protein conserved					
PFL0575w	hypothetical protein, conserved				HMMPfam hit to PF01593, Flavin containing amine oxidase, score 1e-05	
PFL0580w	DNA replication licensing factor mcm5, putative	ATP binding, ATP-dependent DNA helicase activity, DNA-dependent ATPase activity	DNA replication initiation, DNA strand elongation during DNA replication	pre-replicative complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0585w	PfpUB Plasmodium falciparum polyubiquitin	molecular_function	ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	HMMPfam hit to PF00240, Ubiquitin family, score 1.1e-41	<b>attribution</b>:
PFL0590c	non-SERCA-type Ca2+ -transporting P-ATPase	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism, hydrogen ion transporter activity	cation transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0595c	glutathione peroxidase			apicoplast	HMMPfam hit to PF00255, Glutathione peroxidase, score 5.6e-38	<b>attribution</b>:
PFL0600w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	match to EST BI670569.1	
PFL0605c	hypothetical protein, conserved				hypothetical protein	
PFL0610w	hypothetical protein, conserved				match to EST BM274976.1	
PFL0615w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL0620c	glycerol-3-phosphate acytransferase	choline transporter activity	choline transport	integral to plasma membrane, membrane, mitochondrion	annotation change, aeb, 260607. Was previously wrongly annotated as a choline transporter	PfGAT1
PFL0623c	hypothetical protein, conserved				annotation change, aeb, 080405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFL0625c	eukaryotictranslation initiation factor 3 subunit 10, putative	translation initiation factor activity	regulation of translational initiation	eukaryotic translation initiation factor 3 complex	Similar to eukaryotictranslation initiation factor 3 subunit 10 (eif-3 theta) (eukaryotictranslation initiation factor 3 large subunit) (pnla-35) SW:IF3A_TOBAC (Q40554) (958 aa) fasta scores: E(): 5.1e-17, 25.461% id in 1139 aa	<b>attribution</b>:
PFL0630w	iron-sulfur subunit of succinate dehydrogenase	electron carrier activity, succinate dehydrogenase activity	electron transport, tricarboxylic acid cycle	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0635c	bromodomain protein, putative				HMMPfam hit to PF00439, Bromodomain, score 3e-18	
PFL0637c	hypothetical protein, pseudogene				annotation change, aeb, 070405, new gene model defined on the basis of TBLASTX comparison with P. knowlesi	
PFL0640w	hypothetical protein, conserved				hypothetical protein	
PFL0645c	hypothetical protein				match to EST BM275474.1	
PFL0650c	hypothetical protein conserved				hypothetical protein	
PFL0655w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL0660w	dynein light chain 1, putative	microtubule motor activity, motor activity	microtubule-based movement	cytoplasmic dynein complex, microtubule associated complex	HMMPfam hit to PF01221, Dynein light chain type 1, score 2.1e-55	<b>attribution</b>:
PFL0665c	RNA polymerase subunit 8c, putative	DNA-directed RNA polymerase activity	transcription initiation	cellular_component	HMMSmart hit (7.8e-28) to RPOL8c domain	<b>attribution</b>:
PFL0670c	Bi-functional aminoacyl-tRNA synthetase, putative	glutamate-tRNA ligase activity, proline-tRNA ligase activity	tRNA aminoacylation for protein translation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0675c	hypothetical protein, conserved				match to EST BM273850.1	
PFL0680c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0685w	PIG-O homolog, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0690c	hypothetical protein conserved					
PFL0695c	geranylgeranyl transferase type2 beta subunit, putative	molecular_function	protein amino acid geranylgeranylation	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0700w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to EST BM274776.1, BM273818.1	
PFL0705c	adrenodoxin-type ferredoxin, putative	electron carrier activity	electron transport	membrane, mitochondrion	annotation change, aeb. 070405, gene model modified after comparison with P. knowlesi, exons 1 and 2 defined	<b>attribution</b>:
PFL0710w	hypothetical protein, conserved				hypothetical protein	
PFL0715w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to EST BM274031.1	
PFL0720w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0725w	thioredoxin peroxidase 2	antioxidant activity, thioredoxin peroxidase activity	response to oxidative stress	mitochondrion	Pftpx2	<b>attribution</b>:
PFL0730w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0735w	cyclophilin	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding	mitochondrion	HMMPfam hit to PF00160, Cyclophilin type peptidyl-prolyl cis-trans isomerase, score 1.5e-38	
PFL0740c	10 kd chaperonin, putative	unfolded protein binding	response to heat, response to unfolded protein	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0745c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0750w	hypothetical protein, conserved				hypothetical protein	
PFL0755c	hypothetical protein, conserved				hypothetical protein	
PFL0760w	hypothetical protein, conserved				hypothetical protein	
PFL0765w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST AU087030.1	
PFL0770w	seryl-tRNA synthetase, putative	serine-tRNA ligase activity	seryl-tRNA aminoacylation	apicoplast	HMMPfam hit to PF00587, tRNA synthetase class II core domain (G, H, P, S and T), score 1.5e-23	<b>attribution</b>:
PFL0775w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0780w	glycerol-3-phosphate dehydrogenase, putative	glycerol-3-phosphate dehydrogenase (NAD+) activity	glycerol-3-phosphate metabolic process	glycerol-3-phosphate dehydrogenase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0785c	signal recognition particle 19 kd protein, putative	7S RNA binding	SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition	cytoplasm, signal recognition particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0790w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0795c	hypothetical protein, conserved				match to ESTs BM275414.1, BM275724.1	
PFL0800c	hypothetical protein, conserved				hypothetical protein	
PFL0805w	hypothetical protein, conserved					
2277.pre-tRNA-Pro-1	tRNA Proline				anticodon CGG, cove score 70.28	
PFL0815w	DNA-binding chaperone, putative				HMMPfam hit to PF00226, DnaJ domain, score 5.3e-13	<b>attribution</b>:
PFL0820c	hypothetical protein, conserved				hypothetical protein	
PFL0825c	hypothetical protein, conserved					
PFL0830w	hypothetical protein, conserved				HMMPfam hit to PF00076, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), score 1.3e-17	
PFL0835w	GTP-binding protein, putative	GTP binding	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0840c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL0845w	hypothetical protein, conserved				match to ESTs BI814522.1	
PFL0850w	anaphase promoting complex subunit 10					
PFL0855c	hypothetical protein, conserved				hypothetical protein	
PFL0860c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to Homo sapiens unknown (protein for mgc:20197). TR:Q96FX2 (EMBL:AAH10181) (82 aa) fasta scores: E(): 6.4e-12, 51.613% id in 62 aa, and to Drosophila melanogaster cg14701 protein. TR:Q9VGQ9 (EMBL:AE003690) (86 aa) fasta scores: E(): 9.2e-12, 50.000% id in 60 aa	
PFL0865w	hypothetical protein, conserved				match to EST BI936177.1	
PFL0870w	Plasmodium thrombospondin-related apical membrane protein, PTRAMP	molecular_function	biological_process	membrane	PTRAMP	<b>attribution</b>:
PFL0875w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL0880c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL0885w	adaptor protein subunit, puative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0890c	triose Pi or hexose Pi: Pi antiporter; transporter	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0895c	hypothetical protein, conserved				match to EST T18171.1	
PFL0900c	arginyl-tRNA synthetase, putative	arginine-tRNA ligase activity	arginyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0905c	hypothetical protein, conserved				match to ESTs BI814725.1, AU086831.1	
PFL0910c	hypothetical protein, conserved				hypothetical protein	
PFL0915c	hypothetical protein, conserved				hypothetical protein	
PFL0920c	hypothetical protein, conserved				hypothetical protein	
PFL0925w	Formin 2, putative	actin binding	cytokinesis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0930w	clathrin heavy chain, putative	protein transporter activity	receptor-mediated endocytosis	clathrin vesicle coat	HMMPfam hit to PF00637, 7-fold repeat in Clathrin and VPS, score 2.1e-24	<b>attribution</b>:
PFL0935c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	HMMPfam hit to PF03011, Plasmodium falciparum erythrocyte membrane protein (PFEMP), score 1.3e-56
PFL0940c	erythrocyte membrane protein 1(PfEMP-1) pseudogene				Similar to Plasmodium falciparum dbl alpha protein (fragment) TR:Q9XZA0 (EMBL:AF133875) (140 aa) fasta scores: E(): 1.3e-41, 100.000% id in 140 aa, and to Plasmodium falciparum erythrocyte membrane protein 1 TR:O60991 (EMBL:AF003473) (2228 aa) fasta scores: E(): 2.2e-39, 36.588% id in 1055 aa	VAR pseudogene
PFL0945w	erythrocyte membrane protein 1 (PfEMP1) pseudogene				variant-specific surface protein (fragment) TR:Q9Y1N7 (EMBL:AF100791) (438 aa) fasta scores: E(): 1.5e-36, 47.687% id in 281 aa	VAR pseudogene
PFL0950c	aminophospholipid-transporting P-ATPase	phospholipid-translocating ATPase activity	phospholipid transport	integral to membrane, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0955c	phosphatidylethanolamine-binding protein, putative				HMMPfam hit to PF01161, Phosphatidylethanolamine-binding protein, score 3e-79	
PFL0957w	hypothetical protein				annotation change, aeb, 070405, new gene model defined after comparison with P. knowlesi	
PFL0960w	D-ribulose-5-phosphate 3-epimerase, putative	ribulose-phosphate 3-epimerase activity	pentose-phosphate shunt, non-oxidative branch	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL0965c	hypothetical protein, conserved				hypothetical protein	
PFL0970w	pre-mRNA splicing factor, putative	RNA splicing factor activity, transesterification mechanism		spliceosome	HMMSmart hit to SM00320, WD40 repeats, score 1.3e-07	
PFL0972c	hypothetical protein, pseudogene				annotation change, aeb, 070405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFL0973c	hypothetical protein				annotation channge, aeb, 080405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFL0975w	hypothetical protein, conserved				match to EST AU087268.1	
PFL0980w	hypothetical protein, conserved				match to EST BI814036.1	
PFL0985c	hypothetical protein, conserved				match to EST BI813899.1	
PFL0990w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL0995c	hypothetical protein, conserved				hypothetical protein	
PFL1000c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL1005c	chromodomain protein	chromatin binding	chromatin assembly or disassembly	chromatin	HMMPfam hit to PF00385, 'chromo' (CHRromatin Organization MOdifier) domain, score 3.6e-13	
PFL1010c	hypothetical protein conserved					
PFL1015w	hypothetical protein, conserved				hypothetical protein	
PFL1020w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1025c	hypothetical protein, conserved				hypothetical protein	
PFL1030w	hypothetical protein, conserved				match to ESTs BM275453.1, BM273830.1	
PFL1035w	hypothetical protein, conserved				hypothetical protein	
PFL1040w	hypothetical protein conserved					
PFL1045w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1050w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to ESTs BM275761.1, BM274456.1	
PFL1055c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI815230.1	
PFL1060c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, cellular_component	HMMPfam hit to PF01139, Uncharacterized protein family UPF0027, score 4.9e-20	
PFL1065c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST AU086509.1	
PFL1070c	endoplasmin homolog precursor, putative	unfolded protein binding	response to heat	cellular_component	HMMPfam hit to PF00183, Hsp90 protein, score 1.8e-152	
PFL1075w	hypothetical protein, conserved				match to ESTs AU086601.1, AU087115.1	
PFL1080c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMPfam hit to PF01902, Domain of unknown function DUF71, score 2.6e-11	
PFL1085w	hypothetical protein, conserved				hypothetical protein	
PFL1090w	gliding-associated protein 45, GAP45 putative				match to ESTs AU087244.1, N98037.1	<b>attribution</b>:
PFL1095c	hypothetical protein, conserved				match to EST BM274679.1, BM276451.1	
PFL1100w	hypothetical protein, conserved				hypothetical protein	
PFL1105c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1110c	cAMP-dependent protein kinase regulatory subunit, putative	cAMP-dependent protein kinase regulator activity	protein amino acid phosphorylation	cAMP-dependent protein kinase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1115w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1120c	DNA GyrAse a-subunit, putative	ATP binding, DNA topoisomerase (ATP-hydrolyzing) activity	DNA topological change	apicoplast	HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV, subunit A, score 1.1e-87	<b>attribution</b>:
PFL1125w	aminophospholipid-transporting P-ATPase	ATP binding, phospholipid-translocating ATPase activity	aminophospholipid transport	integral to membrane, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1130c	hypothetical protein, conserved				match to ESTs AU087868.1, BI814481.1	
PFL1135c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI815189.1	
PFL1140w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	Similar to Sulfolobus solfataricus hypothetical protein sso3250. TR:Q97TY3 (EMBL:AE006913) (247 aa) fasta scores: E(): 1.8e-13, 29.487% id in 234 aa, and to Arabidopsis thaliana putative membrane protein TR:Q9ZUA5 (EMBL:AC006069) (250 aa) fasta scores: E(): 4e-10, 30.544% id in 239 aa	
PFL1145w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to probable suppressor protein of mitochondrial histone mutant (Neospora crassa) TR:Q9P691 (EMBL:AL355927) (316 aa) fasta scores: E(): 2.2e-07, 30.573% id in 314 aa, and to hypothetical 34.2 kda protein SW:YM78_YEAST (Q04013) (314 aa) fasta scores: E(): 2.5e-07, 31.056% id in 322 aa	
PFL1150c	ribosomal protein L24, putative	structural constituent of ribosome	ribosome biogenesis and assembly	cytosolic large ribosomal subunit (sensu the Bacteria research community), ribonucleoprotein complex	HMMPfam hit to PF00467, KOW motif, score 7.5e-11	<b>attribution</b>:
PFL1155w	GTP cyclohydrolase I	GTP cyclohydrolase I activity	folic acid and derivative biosynthetic process, one-carbon compound metabolic process	cellular_component	HMMPfam hit to PF01227, GTP cyclohydrolase I, score 8.4e-42	<b>attribution</b>:
PFL1160c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	match to EST N98070.1	
PFL1165w	hypothetical protein, conserved				hypothetical protein	
PFL1170w	polyadenylate-binding protein, putative	mRNA binding, poly(A) binding	RNA processing	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1175w	hypothetical protein, conserved				hypothetical protein	
PFL1180w	Chromatin assembly protein (ASF1), putative	chromatin binding, unfolded protein binding	gene silencing	chromatin assembly complex	Similar to Drosophila melanogaster asf1 protein. TR:Q9V464 (EMBL:AE003516) (218 aa) fasta scores: E(): 2.2e-19, 36.709% id in 158 aa	
PFL1185c	cytochrome c heme lyase, putative	holocytochrome-c synthase activity	cytochrome c-heme linkage, electron transport	mitochondrial inner membrane, mitochondrion	HMMPfam hit to PF01265, Cytochrome c/c1 heme lyase, score 5.6e-39	<b>attribution</b>:
PFL1190c	hypothetical protein, conserved				match to EST AU086401.1	
PFL1195w	hypothetical protein, conserved				hypothetical protein	
PFL1200c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion	HMMPfam hit to PF00076, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), score 1.4e-13	
PFL1205c	hypothetical protein, conserved				hypothetical protein	
PFL1210w	hypothetical protein, conserved	ATP binding, aminoacyl-tRNA ligase activity	tRNA aminoacylation for protein translation	apicoplast	HMMPfam hit to PF00133, tRNA synthetases class I (I, L, M and V), score 2.8e-08	
PFL1215c	hypothetical protein, conserved				HMMPfam hit to PF00249, Myb-like DNA-binding domain, score 4.8e-07	
PFL1220w	hypothetical protein, conserved				match to ESTs BI936067.1, BM273760.1	
PFL1225c	hypothetical protein, conserved				hypothetical protein	
PFL1230w	hypothetical protein, conserved				failed but should be on the forward strand, starting at 1035305 and ending at 1036350	
PFL1235c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs BI814559.1, BI815826.1	
PFL1240c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1245w	ubiquitin-activating enzyme e1, putative	ubiquitin activating enzyme activity	ubiquitin cycle	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1250c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1255c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL1260w	hydrolase / phosphatase, putative	catalytic activity, hydrolase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1265c	hypothetical protein, conserved				hypothetical protein	
PFL1270w	cof-like hydrolase, had-superfamily, subfamily iib					
PFL1275c	hypothetical protein, conserved				match to EST BM273826.1	
PFL1280w	hypothetical protein, conserved				hypothetical protein	
PFL1285c	proliferating cell nuclear antigen, putative	DNA polymerase processivity factor activity	regulation of DNA replication		HMMPfam hit to PF00705, Proliferating cell nuclear antigen, N-terminal domain, score 1.5e-29	<b>attribution</b>:
PFL1290w	U3 snoRNP associated protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1295w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	chr12.cand.159 - score = 48.70	
PFL1300c	hypothetical protein, conserved				match to EST BM275924.1	
PFL1305c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI815160.1	
PFL1310c	ATP-dependent RNA helicase, putative	ATP-dependent RNA helicase activity, RNA binding	RNA metabolic process	mitochondrion	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.4e-62	
PFL1315w	K+ channel, potassium channel	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1320w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1325c	hypothetical protein, conserved				match to EST AU087144.1	
PFL1330c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs AU086162.1, BM273655.1	<b>attribution</b>:
PFL1335w	hypothetical protein, conserved				hypothetical protein	
PFL1340c	hypothetical protein, conserved				hypothetical protein	
PFL1345c	radical SAM protein, putative	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1350w	RNA pseudouridylate synthase, putative	molecular_function	RNA modification	cellular_component	Similar to Vibrio cholerae pseudouridine synthase family 1 protein. TR:Q9KPY9 (EMBL:AE004294) (340 aa) fasta scores: E(): 9.2e-05, 27.165% id in 254 aa	<b>attribution</b>:
PFL1355w	hypothetical protein, conserved				hypothetical protein	
PFL1360c	hypothetical protein				hypothetical protein conserved	
PFL1365w	hypothetical protein, conserved				hypothetical protein	
PFL1370w	NIMA-related protein kinase, Pfnek-1	protein serine/threonine kinase activity	mitosis, protein amino acid phosphorylation	cellular_component	HMMPfam hit to PF00069, Protein kinase domain, score 5.6e-78	Pfnek-1
PFL1375w	hypothetical protein, conserved				hypothetical protein	
PFL1380w	hypothetical protein, conserved				HMMPfam hit to PF01479, S4 domain, score 1e-06	
PFL1385c	Merozoite Surface Protein 9, MSP-9				MSP-9	<b>attribution</b>:
PFL1390w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL1395c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs AU086160.1, BI670764.1	
PFL1400c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs BM275457.1, BM274246.1	
PFL1405w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL1410c	ABC transporter, (CT family)	ATP binding, ATPase activity, coupled to transmembrane movement of substances	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1415w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs AU086221.1, AU088190.1	
PFL1420w	macrophage migration inhibitory factor homolog, putative	cytokine activity	evasion of host immune response	cellular_component	HMMPfam hit to PF01187, Macrophage migration inhibitory factor (MIF), score 1.3e-06	
PFL1425w	t-complex protein 1, gamma subunit, putative	ATP binding, unfolded protein binding	protein folding	chaperonin-containing T-complex	HMMPfam hit to PF00118, TCP-1/cpn60 chaperonin family, score 8e-136	
PFL1430c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to ESTs BI815423.1, BM275464.1	
PFL1435c	myosin d	ATP binding, microfilament motor activity	actin filament organization, actin filament-based movement	myosin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1440c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1445w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BM275168.1	
PFL1450c	hypothetical protein, conserved				match to EST BM275166.1	
PFL1455w	hypothetical protein, conserved	molecular_function	biological_process	membrane	HMMPfam hit to PF03105, SPX domain, score 3.1e-13	
PFL1460c	hypothetical protein, conserved				hypothetical protein	
PFL1465c	heat shock protein hslv, putative	ATP-dependent peptidase activity, HslUV protease activity	response to heat, response to unfolded protein	cellular_component	Similar to Rhizobium loti heat shock protein hslv, proteasome-related peptidase subunit mll5007 TR:Q98CT8 (EMBL:AP003005) (177 aa) fasta scores: E(): 3.4e-35, 60.377% id in 159 aa, and to Rickettsia prowazekii ATP-dependent protease hslv hslv or rp319 SW:HSLV_RICPR (Q9ZDK9) (182 aa) fasta scores: E(): 4.1e-29, 54.140% id in 157 aa	<b>attribution</b>:
PFL1470c	hypothetical protein, conserved					
PFL1475w	sun-family protein, putative	methyltransferase activity	metabolic process	cellular_component	HMMPfam hit to PF01189, NOL1/NOP2/sun family, score 9.4e-28	<b>attribution</b>:
PFL1480w	cop-II coated vesicle component, sec13p				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1485w	hypothetical protein, conserved					
PFL1490w	serine/threonine protein kinase, putative				HMMPfam hit to PF01163, RIO1/ZK632.3/MJ0444 family, score 2.2e-55	<b>attribution</b>:
PFL1495w	hypothetical protein, conserved				match to ESTs BM275670.1, BI814396.1	
PFL1500w	Rab2, GTPase	GTP binding, GTPase activity	ER to Golgi vesicle-mediated transport, intracellular protein transport	cellular_component	HMMPfam hit to PF00071, Ras family, score 1.1e-93	<b>attribution</b>:
PFL1505c	hypothetical protein, conserved				hypothetical protein	
PFL1510c	hypothetical protein, conserved				hypothetical protein	
PFL1515c	amino acid transporter	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1520w	dim1 protein homolog, putative	RNA splicing factor activity, transesterification mechanism	spliceosome assembly	spliceosome	HMMPfam hit to PF02966, Mitosis protein DIM1, score 1e-88	
PFL1525c	pre-mRNA splicing factor RNA helicase, putative	ATP-dependent RNA helicase activity	RNA splicing, regulation of progression through cell cycle	spliceosome	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 3.4e-06	<b>attribution</b>:
PFL1530w	asparagine-rich protein, putative				Similar to Plasmodium falciparum asparagine-rich antigen TR:Q25771 (EMBL:X17486) (669 aa) fasta scores: E(): 2e-109, 91.168% id in 668 aa	
PFL1535w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI814176.1	
PFL1540c	phenylalanyl-tRNA synthetase alpha chain, putative	phenylalanine-tRNA ligase activity	phenylalanyl-tRNA aminoacylation	apicoplast	HMMPfam hit to PF01409, tRNA synthetases class II (F), score 1.4e-08	<b>attribution</b>:
PFL1545c	chaperonin, cpn60	unfolded protein binding	protein folding	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1550w	lipoamide dehydrogenase	dihydrolipoyl dehydrogenase activity, thiol-disulfide exchange intermediate activity	electron transport	mitochondrial matrix	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1555w	cytochrome b5, putative	electron carrier activity	electron transport	membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1560c	hypothetical protein, conserved				match to ESTs BM273980.1, BI815451.1	
PFL1565c	hypothetical protein, conserved				match to ESTs BI815281.1, BI815502.1	
PFL1570w	hypothetical protein, conserved				hypothetical protein	
PFL1575w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1580w	hypothetical protein, conserved				hypothetical protein	
PFL1583c	hypothetical protein, conserved				annotation change, aeb, 080405, new gene model defined after comparison with P. knowlesi	
PFL1585c	hypothetical protein, conserved				hypothetical protein	
PFL1590c	elongation factor g, putative	GTP binding, translation elongation factor activity	translational elongation	mitochondrion	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 4.8e-83	<b>attribution</b>:
PFL1595w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to Arabidopsis thaliana F6i1.17 protein f6i1.17 TR:Q9FZ43 (EMBL:AC051629) (144 aa) fasta scores: E(): 8.7e-06, 36.301% id in 146 aa	
PFL1600c	hypothetical protein, conserved				match to EST AU086467.1	
PFL1605w	hypothetical protein, conserved				hypothetical protein	
PFL1610c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1615c	hypothetical protein				Similar to Borrelia burgdorferi hypothetical protein Bb0520 bb0520 SW:Y520_BORBU (O51470) (38 aa) fasta scores: E(): 0.47, 41.667% id in 36 aa	
PFL1620w	asparagine/aspartate rich protein, putative				HMMPfam hit to PF02207, Putative zinc finger in N-recognin, score 8.5e-17	
PFL1625w	hypothetical protein, conserved				hypothetical protein	
PFL1630c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1635w	SUMO-deconjugating enzyme, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1640c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1645w	hypothetical protein, conserved				HMMPfam hit to PF00439, Bromodomain, score 5.6e-14	
PFL1650w	hypothetical protein, conserved				match to ESTs BM273836.1, AU087366.1	
PFL1655c	epsilon DNA polymerase, putative				match to EST AU086485.1	
PFL1660c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1665c	hypothetical protein, conserved				hypothetical protein	
PFL1670c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL1675c	hypothetical protein, conserved				match to ESTs BM276191.1, BM274699.1	
PFL1680w	splicing factor 3b, subunit 3, 130kD, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1685w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion	Similar to Oryza sativa hypothetical 14.2 kda protein TR:Q9AUL2 (EMBL:AC087851) (138 aa) fasta scores: E(): 6.2e-06, 33.333% id in 135 aa, and to Arabidopsis thaliana hypothetical 14.4 kda protein TR:Q9FME9 (EMBL:AB008268) (144 aa) fasta scores: E(): 6.5e-06, 29.139% id in 151 aa	
PFL1690w	hypothetical protein, conserved				Similar to Oryza sativa hypothetical 14.2 kda protein TR:Q9AUL2 (EMBL:AC087851) (138 aa) fasta scores: E(): 6.2e-06, 33.333% id in 135 aa, and to Arabidopsis thaliana hypothetical 14.4 kda protein TR:Q9FME9 (EMBL:AB008268) (144 aa) fasta scores: E(): 6.5e-06, 29.139% id in 151 aa	
PFL1695c	hypothetical protein, conserved				hypothetical protein	
PFL1700c	V-type K+ - independent h+ -translocating inorganic pyrophosphatse	hydrogen-translocating pyrophosphatase activity	proton transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1705w	hypothetical protein, conserved				match to ESTs AU087043.1, BI815090.1	
PFL1710c	tetQ family GTPase, putative	translation elongation factor activity	translational elongation	apicoplast, cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1715w	hypothetical protein, conserved				match to EST AU086705.1	
PFL1720w	Serine hydroxymethyltransferase	glycine hydroxymethyltransferase activity	one-carbon compound metabolic process	cellular_component	HMMPfam hit to PF00464, Serine hydroxymethyltransferase, score 4.6e-198	<b>attribution</b>:
PFL1725w	ATP synthase beta chain, mitochondrial precursor, putative		hydrogen transport	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1730c	hypothetical protein, conserved				hypothetical protein	
PFL1735c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs BM276036.1, AU088432.1	<b>attribution</b>:
PFL1740w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	match to EST AU088432.1	
PFL1745c	clustered-asparagine-rich protein	RNA binding	biological_process	cellular_component	HMMPfam hit to PF00076, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), score 1.4e-16	
PFL1750c	hypothetical protein, conserved				match to EST AU086074.1	
PFL1755w	hypothetical protein, conserved				hypothetical protein	
PFL1760w	hypothetical protein, conserved				match to ESTs AU088458.1, BI815850	
PFL1765c	hypothetical protein, conserved				hypothetical protein	
PFL1770c	hypothetical protein, conserved				hypothetical protein	
PFL1775c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, cellular_component	HMMPfam hit to PF01795, MraW methylase family, score 3.6e-32	
PFL1780w	protein-S-isoprenylcysteine O-methyltransferase, putative	O-methyltransferase activity	gene silencing	apicoplast, integral to membrane	hypothetical protein	
PFL1785c	hypothetical protein, conserved				match to EST N98045.1	
PFL1790w	ubiquitin activating enzyme, putative	ubiquitin activating enzyme activity	ubiquitin cycle	cellular_component	HMMPfam hit to PF00899, ThiF family, score 1.6e-33	<b>attribution</b>:
PFL1795c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BM273482.1	
PFL1800w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1805c	hypothetical protein, conserved				hypothetical protein	
PFL1810w	hypothetical protein, conserved				hypothetical protein	
PFL1815c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to ESTs AU086710.1, BI813860.1	
PFL1820w	hypothetical protein, conserved				hypothetical protein	
PFL1825w	hypothetical protein, conserved	molecular_function	biological_process	membrane	GPI-Anchor Signal predicted for PFL1825w by DGPI v2.04 with cleavage site probability 0.103199996 near 193	match to ESTs BI815314.1, BI815539.1
PFL1830w	ubiquitin-like protein, putative	molecular_function	ubiquitin-dependent protein catabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1835w	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	hypothetical protein, conserved	
PFL1840w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs BI814743.1, BI816386.1	
PFL1845c	calcyclin binding protein, putative	molecular_function	biological_process	membrane	Similar to Mus musculus calcyclin binding protein TR:Q9CXW3 (EMBL:AK013924) (229 aa) fasta scores: E(): 1.5e-16, 31.963% id in 219 aa	
PFL1850c	hypothetical protein, conserved				hypothetical protein	
PFL1855w	cell cycle control protein, putative	molecular_function	regulation of progression through cell cycle	cellular_component	HMMPfam hit to PF02847, MA3 domain, score 1.1e-23	
PFL1860c	hypothetical protein, conserved				hypothetical protein	
PFL1865w	hypothetical protein, conserved				hypothetical protein	
PFL1870c	sphingomyelin phosphodiesterase				match to EST N97823.1	<b>attribution</b>:
PFL1875w	hypothetical protein, conserved	voltage-gated potassium channel activity	potassium ion transport	membrane	HMMPfam hit to PF02214, K+ channel tetramerisation domain, score 2.6e-09	
PFL1880w	acetyl-CoA synthetase, PfACS11	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process, transport	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1885c	calcium/calmodulin-dependent protein kinase 2, putative	calmodulin-dependent protein kinase I activity	protein amino acid phosphorylation	cellular_component	PfPK2	<b>attribution</b>:
PFL1890c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMPfam hit to PF01966, HD domain, score 8.5e-06	
PFL1895w	ribosomal protein L23, putative	structural constituent of ribosome	translation	mitochondrion, ribosome	HMMPfam hit to PF00276, Ribosomal protein L23, score 9.1e-08	<b>attribution</b>:
PFL1900w	hypothetical protein, conserved				Similar to malaria antigen (fragment) TR:Q25914 (EMBL:M63278) (133 aa) fasta scores: E(): 5.1e-34, 98.496% id in 133 aa	
PFL1905w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1910c	hypothetical protein, conserved				match to EST BM273584.1	
PFL1915w	dna gyrase subunit b, putative	DNA topoisomerase (ATP-hydrolyzing) activity	DNA topological change	apicoplast	HMMPfam hit to PF00204, DNA topoisomerase II (N-terminal region), score 4.1e-40	<b>attribution</b>:
PFL1920c	hydroxyethylthiazole kinase, putative	hydroxyethylthiazole kinase activity	thiamin biosynthetic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1925w	cell division protein FtsH, putative	ATP binding, ATP-dependent peptidase activity, metalloendopeptidase activity	proteolysis	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL1930w	hypothetical protein, conserved				match to ESTs AU087536.1, BI814219.1	
PFL1935c	hypothetical protein, conserved				hypothetical protein	
PFL1940w	3-hydroxyisobutyryl-coenzyme A hydrolase, putative	3-hydroxyisobutyryl-CoA hydrolase activity	metabolic process	cellular_component	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase family, score 2.9e-09	
PFL1945c	early transcribed membrane protein 12, ETRAMP12	molecular_function	biological_process	apicoplast, membrane	etramp	etramp 12
PFL1947c	VAR pseudogene, erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	annotation change, aeb, 110405, new gene model defined after TBLASTX comparison with P. knowlesi
PFL1950w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	HMMPfam hit to PF03011, Plasmodium falciparum erythrocyte membrane protein (PFEMP), score 1.7e-54	VAR
PFL1955w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	HMMPfam hit to PF03011, Plasmodium falciparum erythrocyte membrane protein (PFEMP), score 4.5e-61
PFL1960w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	HMMPfam hit to PF03011, Plasmodium falciparum erythrocyte membrane protein (PFEMP), score 9.8e-53
PFL1965w	rifin pseudogene				HMMPfam hit to PF02009, Rifin/stevor family, score 6.2e-41	RIF pseudogene
PFL1970w	erythrocyte membrane protein 1 (PfEMP1)				Similar to Plasmodium falciparum MAL4P2.58, VAR TR:Q9U0G5 (EMBL:AL035475) (2277 aa) fasta scores: E(): 1e-119, 48.607% id in 2440 aa	VAR pseudogene
PFL1975c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMSmart hit to SM00320, WD40 repeats, score 7.5e-08	
PFL1980c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL1985c	hypothetical protein, conserved				match to EST BM276528.1	
PFL1990c	hypothetical protein, conserved				hypothetical protein	
PFL1995c	hypothetical protein, conserved				hypothetical protein	
PFL2000w	mitochondrial carrier protein, putative	binding	transport	membrane, mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2005w	replication factor c subunit 4	ATP binding	DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2010c	DEAD/DEAH box helicase, putative	ATP-dependent RNA helicase activity	RNA metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2015w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	HMMPfam hit to PF00515, TPR Domain, score 2.8e-05	
PFL2020c	hypothetical protein, conserved				hypothetical protein	
PFL2025w	hypothetical protein, conserved				hypothetical protein	
PFL2030w	queuine tRNA ribosyltransferase, putative	queuine tRNA-ribosyltransferase activity	queuosine biosynthetic process	apicoplast, mitochondrion	HMMPfam hit to PF01702, Queuine tRNA-ribosyltransferase, score 1.9e-64	<b>attribution</b>:
PFL2035c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2040w	hypothetical protein, conserved				hypothetical protein	
PFL2045w	hypothetical protein, conserved				hypothetical protein	
PFL2050w	protein geranylgeranyltransferase type II, alpha subunit, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2055w	40S ribosomal protein S17, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2060c	rabGDI protein	Rab GDP-dissociation inhibitor activity, Rab GTPase activator activity	vesicle-mediated transport	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2065c	mitochondrial import inner membrane translocase subunit, putative	protein translocase activity	protein targeting to mitochondrion	mitochondrial inner membrane	HMMPfam hit to PF02953, Tim10/DDP family zinc finger, score 5.5e-10	
PFL2070w	t-SNARE, putative	protein transporter activity, t-SNARE activity	intracellular protein transport	membrane	HMMPfam hit to PF00804, Syntaxin, score 0.0001	<b>attribution</b>:
PFL2075c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMSmart hit to SM00451, U1-like zinc finger, score 1.6e-09	
PFL2080c	hypothetical protein, conserved				hypothetical protein	
PFL2085w	hypothetical protein				hypothetical protein	
PFL2090c	P. falciparum homologue of yeast snf7				Similar to Saccharomyces cerevisiae nuclear protein snf7 SW:SNF7_YEAST (P39929) (240 aa) fasta scores: E(): 5.3e-09, 31.602% id in 231 aa, and to Arabidopsis thaliana hypothetical 24.3 kda protein TR:Q9SZE4 (EMBL:AL078470) (219 aa) fasta scores: E(): 2.3e-07, 29.384% id in 211 aa	
PFL2095w	Translation initiation factor SUI1, putative	translation initiation factor activity	translational initiation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2100w	hypothetical protein, conserved				Contains Plasmodium falciparum Cg2 omega repeats	
PFL2105c	hypothetical protein, conserved				hypothetical protein	
PFL2110c	hypothetical protein, conserved				match to ESTs BM274594.1, BM273586.1	
PFL2115c	glucose inhibited division protein A homologue, putative	molecular_function	biological_process	apicoplast, membrane	HMMPfam hit to PF01134, Glucose inhibited division protein A, score 4.3e-183	
PFL2120w	hypothetical protein, conserved				match to ESTs BM274216.1, N98121.1	
PFL2125c	hypothetical protein, conserved				hypothetical protein	
PFL2130w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	match to ESTs AU087805.1, BI815687.1, BI815424.1	
PFL2135c	hypothetical protein, conserved				hypothetical protein	
PFL2140c	ADP-ribosylation factor GTPase-activating protein	ARF GTPase activator activity, DNA binding	biological_process	cellular_component	HMMPfam hit to PF01412, Putative GTP-ase activating protein for Arf, score 1.4e-36	<b>attribution</b>:
PFL2145w	hypothetical protein, conserved					
PFL2150c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to Homo sapiens uncharacterized hypothalamus protein ht010 TR:Q9NZ37 (EMBL:AF220184) (397 aa) fasta scores: E(): 4.4e-23, 40.061% id in 327 aa	
PFL2155w	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI936165.1	
PFL2160c	hypothetical protein, conserved					
PFL2165w	kinesin-like protein, putative	motor activity	microtubule-based movement	kinesin complex	HMMPfam hit to PF00225, Kinesin motor domain, score 1.1e-58	<b>attribution</b>:
PFL2170c	hypothetical protein, conserved	molecular_function	biological_process	membrane		
PFL2175w	ubiquitin-conjugating enzyme e2, putative	ubiquitin conjugating enzyme activity	ubiquitin cycle	cellular_component	HMMPfam hit to PF00179, Ubiquitin-conjugating enzyme, score 1.7e-11	<b>attribution</b>:
PFL2180w	50S ribosomal protein L3, putative	structural constituent of ribosome	translation	mitochondrial large ribosomal subunit	HMMPfam hit to PF00297, Ribosomal protein L3, score 4.3e-08	<b>attribution</b>:
PFL2185w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to EST BI814399.1	
PFL2190c	hypothetical protein, conserved				HMMPfam hit to PF00225, Kinesin motor domain, score 4.5e-37	
PFL2195w	clathrin coat assembly protein AP180, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2200w	hypothetical protein, conserved				match to EST BI815062.1	
PFL2205w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2210w	delta-aminolevulinic acid synthetase	5-aminolevulinate synthase activity	heme biosynthetic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2215w	actin	structural constituent of cytoskeleton	cytoskeleton organization and biogenesis	actin filament	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2220w	hypothetical protein, conserved				match to EST BI815305.1	
PFL2225w	myosin A tail domain interacting protein MTIP, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2230c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to Pseudomonas aeruginosa hypothetical protein pa0354. TR:Q9I6D9 (EMBL:) (398 aa) fasta scores: E(): 4.7e-15, 25.991% id in 454 aa	
PFL2235w	hypothetical protein, conserved				match to EST BI815013.1	
PFL2240w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2245w	signal recognition particle beta subunit, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2250c	rac-beta serine/threonine protein kinase, PfPKB	ATP binding, protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2255w	hypothetical protein, conserved				match to EST BI816153.1	
PFL2260w	hypothetical protein, conserved				hypothetical protein	
PFL2265c	hypothetical protein, conserved				match to EST BI814102.1	
PFL2270w	mannosyl transferase, putative	molecular_function	biological_process	membrane	putative PIGV homologue invovled in GPI-anchor biosynthesis	<b>attribution</b>:
PFL2275c	FK506-binding protein (FKBP)-type peptidyl-propyl isomerase	FK506 binding, peptidyl-prolyl cis-trans isomerase activity	protein folding	cellular_component	PfFKBP35	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomerase, score 1.6e-39
PFL2280w	cyclin g-associated kinase, putative	cyclin-dependent protein kinase activity, protein serine/threonine kinase activity	protein amino acid phosphorylation	trans-Golgi network transport vesicle	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2285c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to EST BI816194.1	
PFL2290w	preprocathepsin c precursor, putative	dipeptidyl-peptidase I activity	proteolysis	lysosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2295w	hypothetical protein, conserved				hypothetical protein	
PFL2300w	hypothetical protein, conserved				hypothetical protein	
PFL2305w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	Similar to Drosophila melanogaster Cg13929 protein cg13929 TR:Q9W0C0 (EMBL:AE003472) (246 aa) fasta scores: E(): 5e-17, 46.452% id in 155 aa	
PFL2310w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	HMMPfam hit to PF00076, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), score 2.4e-06	
PFL2315c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2320w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast	match to EST BM273915.1	
PFL2325c	P. falciparum homologue of Drosophila nmda1 protein, putative	molecular_function	biological_process	membrane	HMMPfam hit to PF01027, Uncharacterized protein family UPF0005, score 1.1e-28	
PFL2330w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	hypothetical protein	
PFL2335w	hypothetical protein, conserved				match to ESTs BM275086.1, BM276208.1	
PFL2340w	hypothetical protein, conserved				hypothetical protein	
PFL2345c	tat-binding protein homolog	ATPase activity, transcription cofactor activity	ubiquitin-dependent protein catabolic process	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2350c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2355w	hypothetical protein, conserved				match to ESTs BM275171.1, BM274598.1	
PFL2360w	hypothetical protein					
PFL2365w	hypothetical protein, conserved				HMMPfam hit to PF00481, Protein phosphatase 2C, score 2.8e-38	
PFL2370c	hypothetical protein, conserved				match to EST BI813942.1	
PFL2375c	cutA, putative	molecular_function	biological_process	mitochondrion	HMMPfam hit to PF03091, CutA1 divalent ion tolerance protein, score 3.3e-39	
PFL2380c	leucine-rich repeat protein 12, LRR12				match to ESTs BM275126.1, BM274060.1, BM275150.1	
PFL2385c	hypothetical protein, conserved				chr12.C.cand.31 - score = 79.34	
PFL2390c	hypothetical protein, conserved	molecular_function	biological_process	membrane	match to ESTs AU087074.1, BI815941.1	
PFL2395c	dimethyladenosine transferase, putative	rRNA (adenine-N6,N6-)-dimethyltransferase activity	rRNA modification	apicoplast, membrane, mitochondrion	HMMPfam hit to PF00398, Ribosomal RNA adenine dimethylase, score 4.5e-23	<b>attribution</b>:
PFL2400w	hypothetical protein, conserved				match to EST N97996.1	
PFL2405c	PFG377 protein	molecular_function	biological_process	apicoplast	GPI-Anchor Signal predicted for PFL2405c by DGPI v2.04 with cleavage site probability 0.152 near 3088	Similar to Plasmodium falciparum pfg377 TR:Q25857 (EMBL:L04161) (3119 aa) fasta scores: E(): 0, 99.968% id in 3119 aa
PFL2410w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	match to EST AU086753.1	
PFL2415w	Hbeta58/Vps26 protein homolog, putative	molecular_function	retrograde transport, endosome to Golgi	cellular_component	Similar to Mus musculus Vps26 protein homolog vps26 SW:VP26_MOUSE (P40336) (327 aa) fasta scores: E(): 4.7e-66, 53.220% id in 295 aa	
PFL2420w	hypothetical protein, conserved				match to ESTs BM273737.1, BM273440.1	
PFL2425w	adaptor-related protein complex 3, sigma 2 subunit, putative	molecular_function	intracellular protein transport	clathrin vesicle coat	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2430c	eukaryotictranslation initiation factor 2b, subunit 2, putative	GTP binding	translational initiation	eukaryotic translation initiation factor 2B complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2435w	hypothetical protein, conserved				hypothetical protein	
PFL2440w	DNA repair protein rhp16, putative	ATP binding, ATP-dependent helicase activity	nucleotide-excision repair	repairosome	HMMPfam hit to PF00176, SNF2 and others N-terminal domain, score 1.5e-21	<b>attribution</b>:
PFL2445c	hypothetical protein, conserved					
PFL2450c	hypothetical protein, conserved	molecular_function	biological_process	membrane	chr12.C.cand.23 - score = 9.96	
PFL2455w	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2460w	coronin	actin binding	cell motility, cytokinesis, microtubule-based process	cellular_component	HMMSmart hit to SM00320, WD40 repeats, score 6.3e-08	
PFL2465c	thymidylate kinase, putative	ATP binding, thymidylate kinase activity	dTTP biosynthetic process	cellular_component	HMMPfam hit to PF02223, Thymidylate kinase, score 2.4e-40	<b>attribution</b>:
PFL2470c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2475w	DEAD/DEAH box helicase, putative	ATP-dependent RNA helicase activity	RNA metabolic process	cellular_component	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1e-55	<b>attribution</b>:
PFL2480w	hypothetical protein, conserved				match to ESTs AU087112.1, N97705.1	
PFL2485c	tryptophanyl-tRNA synthetase, putative	ATP binding, tryptophan-tRNA ligase activity	tRNA aminoacylation for protein translation	apicoplast, mitochondrion	HMMPfam hit to PF00579, tRNA synthetases class I (W and Y), score 2.9e-07	<b>attribution</b>:
PFL2490c	hypothetical protein, conserved				hypothetical protein	
2277.pre-tRNA-Val-1	tRNA Valine				anticodon AAC, cove score 76.6	
2277.pre-tRNA-Glu-1	tRNA Glutamine				anticodon TTG, cove score 70.9	
PFL2505c	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, membrane	match to ESTs AU088159.1, AU088073.1	
PFL2510w	chitinase	chitin binding, chitinase activity	chitin catabolic process	cellular_component	Identical to Plasmodium falciparum chitinase TR:Q9U4I9 (EMBL:AF172445) (378 aa) fasta scores: E(): 7.6e-145, 100.000% id in 378 aa	
PFL2515c	hypothetical protein, conserved	molecular_function	biological_process	membrane	hypothetical protein	
PFL2520w	Plasmodium falciparum, reticulocyte binding-like protein, homolog 3				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2525c	hypothetical protein	molecular_function	biological_process	membrane	hypothetical protein	
PFL2530w	hypothetical protein, conserved				hypothetical protein	
PFL2535w	RESA-like protein, putative				Similar to Plasmodium falciparum ring-infected erythrocyte surface antigen precursor resA SW:RESA_PLAFF (P13830) (1073 aa) fasta scores: E(): 3.3e-12, 24.711% id in 433 aa	
PFL2540w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	hypothetical protein	
PFL2545c	hypothetical protein				hypothetical protein	
PFL2550w	hypothetical protein, conserved in P. falciparum	unfolded protein binding	protein folding	membrane	HMMPfam hit to PF00226, DnaJ domain, score 1.3e-13	
PFL2555w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane		
PFL2560c	hypothetical protein, conserved in P. falciparum				hypothetical protein	
PFL2565w	hypothetical protein, consevred in P. falciparum	molecular_function	biological_process	apicoplast	hypothetical protein	
PFL2570w	acyl-coa synthetase, PfACS3	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process, transport	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFL2575c	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	apicoplast		
PFL2580w	rifin, pseudogene	molecular_function	biological_process	membrane	RIF, pseudogene	annotation change, aeb, 110405, gene model radically modified, was previously a hypothetical protein, now a RIFIN pseudogene
PFL2585c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFL2590w	hypothetical protein, onserved in P. falciparum	molecular_function	biological_process	membrane	hypothetical protein	
PFL2595w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	hypothetical protein	
PFL2600w	hypothetical protein, conserved in P. falciparum				hypothetical protein	
PFL2605w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	HMMPfam hit to PF02009, Rifin/stevor family, score 3.4e-143
PFL2610w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)	HMMPfam hit to PF02009, Rifin/stevor family, score 7.6e-103
PFL2615w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFL2620w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	HMMPfam hit to PF02009, Rifin/stevor family, score 3.1e-93	stevor
PFL2625w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	HMMPfam hit to PF02009, Rifin/stevor family, score 3e-126	RIF
PFL2630w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFL2635w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	HMMPfam hit to PF02009, Rifin/stevor family, score 3.9e-101	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)
PFL2640c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFL2645c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFL2650w	hypothetical protein, conserved in P. falciparum					
PFL2655w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFL2660w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	HMMPfam hit to PF02009, Rifin/stevor family, score 6e-156	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFL2665c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	HMMPfam hit to PF03011, Plasmodium falciparum erythrocyte membrane protein (PFEMP), score 4.3e-59
PF14_0001	erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0002	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0003	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0004	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0005	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0006	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0007	stevor, putative	molecular_function	biological_process	cellular_component, membrane		
PF14_0008	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0009	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0010	glycophorin binding protein-related antigen	molecular_function	biological_process	membrane		
PF14_0013	hypothetical protein					
PF14_0014	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0015	aminopeptidase, putative	hydrolase activity	biological_process	apicoplast, membrane		
PF14_0016	early transcribed membrane protein 14.1, etramp14.1	molecular_function	biological_process	membrane	etramp14.1	
PF14_0017	lysophospholipase, putative	hydrolase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0018	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0019	hypothetical protein					
PF14_0020	choline kinase, putative	choline kinase activity	lipid metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0021	hypothetical protein					
PF14_0022	exopolyphosphatase, putative	exopolyphosphatase activity	polyphosphate metabolic process	membrane	annotation, aeb, 050504, gene model modifed, terminal exon added after comparison with P. knowlesi	
PF14_0023	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0024	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0025	proteosome subunit, putative	endopeptidase activity	proteolysis	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0026	hypothetical protein					
PF14_0027	ribosomal S27a, putative	structural constituent of ribosome	biological_process	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0028	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0029	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0030	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0031	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0032	hypothetical protein					
PF14_0810	hypothetical protein, conserved					
PF14_0033	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0034	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0035	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0036	acid phosphatase, putative					
PF14_0037	hypothetical protein					
PF14_0038	cytochrome c, putative		electron transport	mitochondrial electron transport chain, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0039	hypothetical protein					
PF14_0040	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0041	ribosomal protein L16, putative	structural constituent of ribosome	translation	plastid large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0042	U3 small nucleolar ribonucleoprotein, U3 snoRNP, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0043	hypothetical protein					
PF14_0788	hypothetical protein, conserved				annotation change, aeb, 050405, new gene model defined after TBLASTX comparision with P. knowlesi	
PF14_0044	hypothetical protein					
PF14_0045	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0046	hypothetical conserved in Plasmodium species				possible ER retention signal (SDEL) at C-terminus.	
PF14_0047	hypothetical protein					
PF14_0048	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0049	hypothetical protein					
PF14_0050	hypothetical protein					
PF14_0051	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, cellular_component		
PF14_0052	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0053	ribonucleotide reductase small subunit	ribonucleoside-diphosphate reductase activity	DNA replication	cellular_component	RNR	<b>attribution</b>:
PF14_0054	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0055	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0056	hypothetical protein				RN	
PF14_0057	RNA binding protein, putative	mRNA binding		cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0058	hypothetical protein					
PF14_0059	hypothetical protein					
PF14_0060	glycerophodiester phosphodiesterase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0061	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0062	hypothetical protein					
PF14_0063	ATP-dependent Clp protease, putative	ATP binding, endopeptidase Clp activity	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0064	vacuolar protein sorting 29, putative					
PF14_0065	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0066	radical SAM protein, putative	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0067	hypothetical protein					
PF14_0068	fibrillarin, putative	molecular_function	rRNA processing	mitochondrion, small nucleolar ribonucleoprotein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0069	hypothetical protein					
PF14_0070	hypothetical protein					
PF14_0071	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0072	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0073	hypothetical protein					
PF14_0074	hypothetical protein					
PF14_0075	plasmepsin, putative	aspartic-type endopeptidase activity	hemoglobin catabolic process	food vacuole, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0076	plasmepsin 1 precursor	aspartic-type endopeptidase activity	hemoglobin catabolic process	food vacuole, membrane	pfapg;	<b>attribution</b>:
PF14_0077	plasmepsin 2	aspartic-type endopeptidase activity	hemoglobin catabolic process	food vacuole, membrane	plasmepsin II GFP fusion to show the localization and trafficking of this protein to the food vacuole.	<b>attribution</b>:
PF14_0078	HAP protein	aspartic-type endopeptidase activity	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0079	hypothetical protein					
PF14_0080	hypothetical protein					
PF14_0081	DNA repair helicase, putative	DNA helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0082	hypothetical protein					
PF14_0083	ribosomal protein S8e, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0084	hypothetical protein					
PF14_0085	hypothetical protein					
PF14_0086	hypothetical protein					
PF14_0087	hypothetical protein					
PF14_0088	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0089	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0090	hypothetical protein					
PF14_0091	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0092	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0093	hypothetical protein					
PF14_0094	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0095	hypothetical protein					
PF14_0096	hypothetical protein					
PF14_0097	cytidine diphosphate-diacylglycerol synthase	phosphatidate cytidylyltransferase activity	phospholipid biosynthetic process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0098	hypothetical protein					
PF14_0099	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0100	cytidine triphosphate synthetase	CTP synthase activity	pyrimidine base metabolic process	cellular_component	2 frameshifts;	<b>attribution</b>:
PF14_0101	hypothetical protein					
PF14_0102	rhoptry-associated protein 1, RAP1	molecular_function	biological_process	rhoptry	RAP1	<b>attribution</b>:
PF14_0103	hypothetical protein					
PF14_0104	eukaryotictranslation initiation factor 2 gamma subunit, putative	GTP binding	translational initiation	eukaryotic translation initiation factor 2 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0105	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0106	hypothetical protein					
PF14_0107	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0108	hypothetical protein					
PF14_0109	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0778	hypothetical protein, conserved				annotation change, aeb, 050504, new gene model defined after comparison with P. knowlesi	
PF14_0110	rhomboid protease, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0111	hypothetical protein					
PF14_0112	POM1, putative	DNA-directed DNA polymerase activity	biological_process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0113	hypothetical protein					
PF14_0114	GTP-binding protein, putative	GTP binding	biological_process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0115	hypothetical protein					
PF14_0116	hypothetical protein					
PF14_0117	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0118	hypothetical protein					
PF14_0119	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0120	hypothetical protein					
PF14_0121	hypothetical protein					
PF14_0122	nuclear transport factor 2, putative	molecular_function	protein import into nucleus	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0123	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0124	actin II	microfilament motor activity, structural constituent of cytoskeleton	cytoskeleton organization and biogenesis	actin filament	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0125	deoxyhypusine synthase		hypusine biosynthetic process from peptidyl-lysine, spermidine catabolic process to deoxyhypusine, using deoxyhypusine synthase, translation	membrane		
PF14_0126	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0127	N-myristoyltransferase	glycylpeptide N-tetradecanoyltransferase activity	N-terminal protein myristoylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0128	ubiquitin conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin-dependent protein catabolic process	cellular_component		
PF14_0129	hypothetical protein					
PF14_0130	hypothetical protein					
PF14_0131	hypothetical protein					
PF14_0132	ribosomal protein S9, putative	structural constituent of ribosome	translation	apicoplast, plastid small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0133	ATP-dependent transporter, putative	ATPase activity, coupled to transmembrane movement of substances	transport	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0134	hypothetical protein					
PF14_0135	hypothetical protein					
PF14_0136	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0137	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0138	hypothetical protein				annotation change, 050405, aeb, gene model modified, intron inserted after TBLASTX comparison with P. knowlesi. Exon IV defined (554268..554349)	
PF14_0139	hypothetical protein					
PF14_0140	hypothetical protein					
PF14_0141	ribosomal protein L10, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0142	serine/threonine protein phosphatase, putative	protein phosphatase type 1 activity	protein amino acid dephosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0143	protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0144	mRNA capping enzyme, putative	mRNA guanylyltransferase activity	mRNA capping	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0145	deubiquitinising protease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0146	ribonucleoprotein, putative	molecular_function	RNA splicing	spliceosome		
PF14_0147	ATP-dependent protease, putative	ATP-dependent peptidase activity, serine-type endopeptidase activity	ATP-dependent proteolysis	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0148	uracil-DNA glycosylase, putative	uracil DNA N-glycosylase activity	base-excision repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0149	hypothetical protein					
PF14_0150	RNA polymerase small subunit, putative	DNA-directed RNA polymerase activity	transcription	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0151	hypothetical protein					
PF14_0152	hypothetical protein					
PF14_0153	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0154	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0155	serine C-palmitoyltransferase, putative	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0156	dimethyladenosine transferase, putative	rRNA methyltransferase activity	rRNA modification	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0157	hypothetical protein					
PF14_0158	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0159	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0160	hypothetical protein					
PF14_0161	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0162	hypothetical protein					
PF14_0163	hypothetical protein					
PF14_0164	NADP-specific glutamate dehydrogenase	glutamate dehydrogenase (NADP+) activity	glutamate metabolic process	cellular_component	GDH;	<b>attribution</b>:
PF14_0165	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0805	hypothetical protein, conserved				annotation change, aeb, 060504, new gene model defined after TBLASTX comparison with P. knowlesi	
PF14_0166	lysine -- tRNA ligase, putative	lysine-tRNA ligase activity	lysyl-tRNA aminoacylation	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0167	hypothetical protein					
PF14_0168	hypothetical protein					
PF14_0169	hypothetical protein					
PF14_0170	hypothetical protein					
PF14_0171	hypothetical protein					
PF14_0172	hypothetical protein					
PF14_0173	hypothetical protein					
PF14_0174	small nucleolar ribonucleoprotein, snoRNP, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0176	hypothetical protein					
PF14_0177	DNA replication licensing factor MCM2	molecular_function	DNA replication, regulation of progression through cell cycle	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0178	hypothetical protein	molecular_function	biological_process	membrane	annotation change, aeb, 060405, gene model modified after TBLASTX comparison with P. knowlesi. Exons I, II and III added. Gene model formerly a 5 exon model	
PF14_0179	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0180	hypothetical protein					
PF14_0181	calmodulin, putative	calcium ion binding	biological_process	cellular_component		
1396.pre-tRNA-Pro-1	tRNA Proline				anticodon AGG. cove score 73.97	
MAL14_5S_1						
MAL14_5S_2						
MAL14_5S_3						
PF14_0183	RNA helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0184	hypothetical protein					
PF14_0185	ATP-dependent RNA helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component		
PF14_0186	hypothetical protein					
PF14_0187	glutathione S-transferase	glutathione transferase activity		cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0188	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0189	hypothetical protein					
PF14_0190	hypothetical protein					
PF14_0191	hypothetical protein					
PF14_0192	glutathione reductase	glutathione-disulfide reductase activity	response to oxidative stress	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0193	hypothetical protein					
PF14_0194	spliceosome-associated protein, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0195	hypothetical protein					
PF14_0196	hypothetical protein					
PF14_0197	hypothetical protein					
PF14_0198	glycine -- tRNA ligase, putative	glycine-tRNA ligase activity	glycyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0199	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0200	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0201	surface protein, putative, Pf113	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0202	dynein-associated protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0774	mannose-1-phosphate guanyltransferase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0775	hypothetical protein					
PF14_0204	hypothetical protein					
PF14_0205	ribosomal protein S25, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community), membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0206	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0207	RNA polymerase subunit, putative	DNA-directed RNA polymerase activity	regulation of transcription, DNA-dependent	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0208	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0209	hypothetical protein					
PF14_0210	hypothetical protein					
PF14_0211	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0787	hypothetical protein				annotation change, aeb, 060405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF14_0212	hypothetical protein					
PF14_0213	hypothetical protein					
PF14_0214	hypothetical protein					
PF14_0215	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0216	hypothetical protein					
PF14_0217	hypothetical protein				1 frameshift;	
PF14_0218	actin-related protein homolog, arp4 homolog	structural constituent of cytoskeleton	cytoskeleton organization and biogenesis, endocytosis, exocytosis	actin filament	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0219	hypothetical protein					
PF14_0220	hypothetical protein					
PF14_0221	Ran protein, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0222	hypothetical protein					
PF14_0223	cyclophilin, putative	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	biological_process	cellular_component	cyclophilin, putative {Plasmodium falciparum 3D7;} similar to Peptidyl-prolyl cis-trans isomerase 10 (EC 5.2.1.8) (PPIase)(Rotamase) (Cyclophilin-10). (Swiss-Prot:P52017) (Caenorhabditis elegans;)	
PF14_0224	PP1-like protein serine/threonine phosphatase	protein serine/threonine phosphatase activity	protein amino acid dephosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0225	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0226	hypothetical protein					
PF14_0227	calcium-dependent protein kinase, putative	calcium- and calmodulin-dependent protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0228	hypothetical protein					
PF14_0229	hypothetical protein				annotation change, aeb, 060405, gene model modified, exon III defined after TBLASTX comparison with P. knowlesi.	
PF14_0230	Ribosomal protein family L5, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0231	ribosomal protein L7a, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0232	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion		
PF14_0233	hypothetical protein					
PF14_0234	DNA-directed DNA polymerase, putative	DNA-directed DNA polymerase activity, helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0235	hypothetical protein					
PF14_0236	hypothetical protein					
PF14_0237	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0238	hypothetical protein					
PF14_0239	hypothetical protein					
PF14_0240	ribosomal protein L21e, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0241	basictranscription factor 3b, putative	molecular_function	biological_process	nascent polypeptide-associated complex, transcription factor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0242	arginine n-methyltransferase, putative	arginine N-methyltransferase activity	biological_process	cellular_component		
PF14_0243	dynein-associated protein, putative	microtubule motor activity	microtubule-based movement	cytoskeleton	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0244	ABC transporter, (EPP family)	ATPase activity, coupled to transmembrane movement of substances	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0245	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0246	phosphoenolpyruvate carboxylase, putative	phosphoenolpyruvate carboxylase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0247	hypothetical protein					
PF14_0248	ubiquinol-cytochrome c reductase hinge protein, putative	ubiquinol-cytochrome-c reductase activity	mitochondrial electron transport, ubiquinol to cytochrome c	mitochondrion, respiratory chain complex III (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0249	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0250	hypothetical protein					
PF14_0251	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0252	hypothetical protein					
PF14_0253	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0254	DNA mismatch repair protein Msh2p, putative	damaged DNA binding	mismatch repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0255	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0256	exosome complex exonuclease rrp41, putative	exonuclease activity	rRNA processing	exosome (RNase complex)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0257	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0258	hypothetical protein					
PF14_0259	hypothetical protein					
PF14_0260	metabolite/drug transporter	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0261	proliferation-associated protein 2g4, putative	methionyl aminopeptidase activity	cell cycle arrest, cell proliferation	cellular_component	p38-2g4;	<b>attribution</b>:
PF14_0262	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0263	hypothetical protein					
PF14_0264	protein kinase, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0265	peptide chain release factor 1, putative	translation release factor activity	translational termination	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0266	hypothetical protein	molecular_function	biological_process	mitochondrion		
PF14_0267	transcription initiation TFIID-like, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0268	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF14_0269	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0270	ribosomal protein L15, putative	structural constituent of ribosome	translation	apicoplast, organellar large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0271	hypothetical protein					
PF14_0272	hypothetical protein					
PF14_0273	hypothetical protein					
PF14_0274	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0275	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0276	ribosomal protein L15, putative	structural constituent of ribosome	translation	mitochondrial large ribosomal subunit, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0277	coatamer protein, beta subunit, putative	molecular_function	retrograde vesicle-mediated transport, Golgi to ER	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0278	ATP-dependent DNA helicase, putative	ATP-dependent DNA helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0279	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0280	phosphotyrosyl phosphatase activator, putative	protein tyrosine phosphatase activator activity	protein amino acid dephosphorylation	cellular_component		
PF14_0281	aspartyl protease, putative	aspartic-type endopeptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0282	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0283	hypothetical protein					
PF14_0284	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0285	exodeoxyribonuclease III, putative	deoxyribonuclease activity	biological_process	cellular_component		
PF14_0286	glutamate dehydrogenase, putative	glutamate dehydrogenase (NADP+) activity	amino acid metabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0287	hypothetical protein					
PF14_0288	cytochrome c oxidase subunit II precursor, putative	cytochrome-c oxidase activity	biological_process	mitochondrion, respiratory chain complex IV (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0289	ribosomal protein L17, putative	structural constituent of ribosome	translation	mitochondrion, organellar large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0290	hypothetical protein				antigen 7H8/1;	
PF14_0291	hypothetical protein					
PF14_0292	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0293	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0294	mitogen-activated protein kinase 1, PfMAP1	MAP kinase activity	MAPKKK cascade, protein amino acid phosphorylation	cellular_component	PfMAP1	<b>attribution</b>:
PF14_0295	ATP-specific succinyl-CoA synthetase beta subunit, putative	succinate-CoA ligase (ADP-forming) activity	succinyl-CoA metabolic process, tricarboxylic acid cycle	mitochondrial matrix, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0296	ribosomal protein L14, putative	structural constituent of ribosome	translation	apicoplast, cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0297	ecto-nucleoside triphosphate diphosphohydrolase 1, putative	nucleoside-diphosphatase activity, nucleoside-triphosphatase activity	biological_process	membrane	apyrase;	<b>attribution</b>:
PF14_0298	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0299	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0300	syntaxin, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0301	hypothetical protein	molecular_function	biological_process	mitochondrion		
PF14_0302	hypothetical protein					
PF14_0303	hypothetical protein					
PF14_0304	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0305	nuclear mRNA export factor, TAP homolog, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0306	hypothetical protein					
PF14_0785	hypothetical protein				annotation change, aeb, 060405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF14_0307	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0308	XPC homolog				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0309	protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase, putative	protein-L-isoaspartate (D-aspartate) O-methyltransferase activity	protein repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0310	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0311	hypothetical protein					
PF14_0784	Ribosome biogenesis protein, NOP10-like				annotation change, aeb, 040405, new gene model defined after TBLASTX comparison to P. knowlesi	
PF14_0312	hypothetical protein					
PF14_0313	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0314	chromatin assembly factor 1 p55 subunit, putative	histone binding, unfolded protein binding	nucleosome assembly	chromatin assembly complex, chromatin remodeling complex, membrane		
PF14_0315	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0316	DNA topoisomerase II, putative	DNA topoisomerase (ATP-hydrolyzing) activity	DNA topological change	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0317	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	annotation change, aeb, 040405, gene model modifed after TBLASTX comaprison with P. knowlesi	
PF14_0318	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0319	hypothetical protein					
PF14_0320	protein kinase, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0321	ABC transporter, putative	ATPase activity, coupled to transmembrane movement of substances	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0322	hypothetical protein					
PF14_0323	calmodulin	calcium ion binding, enzyme binding	biological_process	cellular_component		
PF14_0324	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0325	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0326	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0327	methionine aminopeptidase, type II, putative	methionyl aminopeptidase activity	protein modification, regulation of translation, translation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0328	mitochondrial import inner membrane translocase subunit tim17, putative	protein transporter activity	protein targeting to mitochondrion, protein transport	membrane, mitochondrial inner membrane presequence translocase complex, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0329	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion		
PF14_0330	hypothetical protein					
PF14_0331	cytochrome c oxidase assembly protein, putative	molecular_function	cytochrome c oxidase complex assembly	membrane, mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0332	hypothetical protein					
PF14_0333	hypothetical protein					
PF14_0334	NAD(P)H-dependent glutamate synthase, putative	glutamate synthase activity	glutamate metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0335	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0336	hypothetical protein					
PF14_0337	hypothetical protein					
PF14_0338	hypothetical protein					
PF14_0339	hypothetical protein					
PF14_0340	hypothetical protein					
PF14_0341	glucose-6-phosphate isomerase	glucose-6-phosphate isomerase activity	gluconeogenesis, glycolysis, pentose-phosphate shunt	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0342	ion channel, putative	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0343	hypothetical protein					
PF14_0344	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0345	hypothetical protein					
PF14_0346	cGMP-dependent protein kinase 1, beta isozyme, putative	cGMP-dependent protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0347	hypothetical protein					
PF14_0348	ATP-dependent Clp protease proteolytic subunit, putative	endopeptidase Clp activity	proteolysis	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0349	histidine triad protein, putative	zinc ion binding	biological_process	cellular_component		
PF14_0350	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0351	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0352	ribonucleoside-diphosphate reductase, large subunit	molecular_function	DNA replication	ribonucleoside-diphosphate reductase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0353	hypothetical protein					
PF14_0354	hypothetical protein					
PF14_0355	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0356	hypothetical protein					
PF14_0357	acetyl CoA synthetase, putative	acetate-CoA ligase activity	glycolysis, tricarboxylic acid cycle	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0358	41-2 protein antigen precursor	molecular_function	biological_process	host cell plasma membrane		
PF14_0359	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0360	hypothetical protein					
PF14_0361	translocation protein sec62, putative	molecular_function	SRP-dependent cotranslational protein targeting to membrane	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL14_tRNA.SelCys1	tRNA Selenocysteine tRNA, putative					
1396.pre-tRNA-Met-1	tRNA Methionine				anticodon CAT, cove score 80.56	
PF14_0362	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0363	metacaspase-like protein	molecular_function	biological_process	membrane	Based on Blastp evidence	
PF14_0364	cleavage and polyadenylation specifity factor protein, putative	molecular_function	mRNA cleavage, mRNA polyadenylation	mRNA cleavage and polyadenylation specificity factor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0365	hypothetical protein					
PF14_0366	small subunit DNA primase	DNA primase activity	DNA replication, synthesis of RNA primer	alpha DNA polymerase:primase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0367	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0368	2-Cys peroxiredoxin	thioredoxin peroxidase activity	response to oxidative stress	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0369	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0370	RNA helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0371	hypothetical protein				1 frameshift;	
PF14_0372	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0373	iron-sulphur protein subunit of the cytochrome bc1 complex	ubiquinol-cytochrome-c reductase activity	electron transport	mitochondrion, respiratory chain complex III (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0374	hypothetical protein					
PF14_0375	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0376	hypothetical protein	molecular_function	biological_process	membrane	annotation change, aeb, 040405, gene model modified after TBLASTX comparison with P. knowlesi. Exons I and II defined. Former exon I truncated by 25 aa	
PF14_0377	vesicle-associated membrane protein, putative	molecular_function	membrane fusion, vesicle-mediated transport	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0378	triose-phosphate isomerase	triose-phosphate isomerase activity	fatty acid biosynthetic process, gluconeogenesis, glycolysis, pentose-phosphate shunt	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0379	hypothetical protein					
PF14_0380	hypothetical protein					
PF14_0381	delta-aminolevulinic acid dehydratase	porphobilinogen synthase activity	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0382	metalloendopeptidase, putative	metalloendopeptidase activity	proteolysis	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0383	hypothetical protein				Krueppel-like protein;	
PF14_0384	hypothetical protein				weak similarity to allantoicase SP:Q9W6S5;	
PF14_0385	hypothetical protein					
PF14_0386	hypothetical protein					
PF14_0387	metabolite/drug transporter	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0388	hypothetical protein					
PF14_0389	hypothetical protein					
PF14_0390	hypothetical protein					
PF14_0391	ribosomal protein L1, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0392	Ser/Thr protein kinase, putative	protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0393	structure specific recognition protein, putative	DNA binding, single-stranded DNA binding	biological_process	cellular_component		
PF14_0394	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0395	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0396	hypothetical protein					
PF14_0397	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0398	hypothetical protein					
PF14_0399	ADP-ribosylation-like factor, putative	GTPase activity	protein amino acid ADP-ribosylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0783	hypothetical protein				annotation change, aeb, 040405, new gene model defined after TBLASTX comparson with P. knowlesi	
PF14_0400	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0401	methionine -- tRNA ligase, putative	aminoacyl-tRNA ligase activity	tRNA aminoacylation for protein translation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0402	hypothetical protein					
PF14_0403	protein prenyltransferase alpha subunit, putative	Rab-protein geranylgeranyltransferase activity, protein geranylgeranyltransferase activity	biological_process	cellular_component	annotation change, aeb, 0404005, gene model modified, exons added after TBLASTX comparison with P. knowlesi. Exons 4 to 8 defined. Inteon defined in Exon III	<b>attribution</b>:
PF14_0404	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0405	hypothetical protein					
PF14_0406	hypothetical protein					
PF14_0407	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0408	Ser/Thr protein kinase, putative	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0409	hypothetical protein					
PF14_0410	hypothetical protein					
PF14_0411	small nuclear ribonuclear protein, putative	molecular_function	RNA splicing	small nucleolar ribonucleoprotein complex		
PF14_0412	hypothetical protein					
PF14_0413	hypothetical protein					
PF14_0414	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0415	dephospho-CoA kinase, putative	dephospho-CoA kinase activity	coenzyme A biosynthetic process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0416	hypothetical protein					
PF14_0417	heat shock protein, putative	ATPase activity, coupled	response to heat	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0418	hypothetical protein					
PF14_0419	hypothetical protein					
PF14_0420	hypothetical protein					
PF14_0421	1-acylGlycerol-3-phosphate O-acyltransferase	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0422	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0423	Ser/Thr protein kinase, putative	ATP binding, protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0781	hypothetical protein				annotation change, aeb, 050405, new gene model defined after TBLASX comparison with P. knowlesi	
PF14_0424	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0425	fructose-bisphosphate aldolase	fructose-bisphosphate aldolase activity	gluconeogenesis, glycolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0426	hypothetical protein					
PF14_0427	hypothetical protein					
PF14_0428	histidine -- tRNA ligase, putative	histidine-tRNA ligase activity	tRNA aminoacylation for protein translation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0429	RNA helicase, putative	helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0430	hypothetical protein					
PF14_0431	serine/threonine kinase-1, PfLammer	protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0432	hypothetical protein					
PF14_0433	hypothetical protein					
PF14_0434	hypothetical protein					
PF14_0435	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	annotation change, aeb, 040405,gene model modified after TBLASTX comparison woth P. knowlesi. Exons 2 and 3 defined.	
PF14_0436	helicase, truncated, putative	helicase activity	biological_process	cellular_component		
PF14_0437	helicase, truncated, putative	helicase activity, nucleic acid binding	biological_process	cellular_component		
PF14_0438	hypothetical protein					
PF14_0439	leucine aminopeptidase, putative	leucyl aminopeptidase activity	proteolysis	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0440	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0441	pyruvate dehydrogenase E1 beta subunit, putative	molecular_function	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0442	hypothetical protein					
PF14_0443	centrin, putative	calcium ion binding	biological_process	microtubule organizing center	caltractin, putative;	
PF14_0444	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0445	hypothetical protein					
PF14_0446	hypothetical protein					
PF14_0447	glutaminyl-peptide cyclotransferase	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0448	ribosomal protein S2, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0449	hypothetical protein					
PF14_0450	hypothetical protein					
PF14_0451	mitochondrial ribosomal protein S14 precursor, putative	structural constituent of ribosome	translation	mitochondrial small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0790	hypothetical protein, conserved				annotation change, aeb, 070405, new gene model defined using SNAP	SNAP prediction, on sequence MAL14 score 14.260
PF14_0452	hypothetical protein					
PF14_0453	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0454	hypothetical protein					
PF14_0455	multidrug resistance protein 2 (heavy metal transport family)	ATPase activity, coupled to transmembrane movement of substances	multidrug transport	cellular_component	Pfmdr2;	PfMDR2
PF14_0456	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0457	hypothetical protein					
PF14_0458	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0460	hypothetical protein, conserved				PF14_0459 now incorporated into PF14_0460	annotation change, aeb, 050405, gene model modified after TBLASTX comparison with P. knowlesi. Exons 3, 4 and 5 defined. These bridge, and thus caused to fuse, genes PF14_0459 and PF14_0460. Exon 6 was formerly exonI of PF14_0459. Exons 8 and 9 newly defined
PF14_0461	hypothetical protein					
PF14_0462	SEL-1 protein, putative	molecular_function	biological_process	cellular_component		
PF14_0463	chloroquine resistance marker protein	molecular_function	biological_process	nucleus		
PF14_0464	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0465	hypothetical protein					
PF14_0466	hypothetical protein					
PF14_0815	hypothetical protein				annotation change, aeb, 050405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF14_0467	hypothetical protein					
PF14_0468	hypothetical protein					
PF14_0469	transcription factor IIIb subunit, putative	RNA polymerase III transcription factor activity	transcription initiation from RNA polymerase III promoter	transcription factor TFIIIB complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0470	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0471	hypothetical protein					
PF14_0472	hypothetical protein					
PF14_0473	3'-5' exonuclease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0474	hypothetical protein					
PF14_0475	hypothetical protein					
PF14_0476	serine/threonine protein kinase, putative	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0477	signal recognition particle 54 kDa protein, putative	signal sequence binding	SRP-dependent cotranslational protein targeting to membrane	signal recognition particle (sensu the Eukaryota research community)	SRP54;	<b>attribution</b>:
PF14_0478	hypothetical protein					
PF14_0479	hypothetical protein					
PF14_0480	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0481	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0482	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0483	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0484	acetyl-CoA acetyltransferase, putative	acetyl-CoA C-acetyltransferase activity	fatty acid metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0485	hypothetical protein					
PF14_0486	elongation factor 2	GTP binding, translation elongation factor activity	translational elongation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0487	hypothetical protein					
PF14_0488	hypothetical protein				annotation change, aeb, 050405, gene model modified after TBLASTX comparison to P. knowlesi. Exons 7, 8 and 9 defined. Was formerly a 6 exon gene model	
PF14_0489	histone deacetylase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0490	hypothetical protein					
PF14_0491	hypothetical protein					
PF14_0492	protein phosphatase 2b regulatory subunit, putative	calcium-dependent protein serine/threonine phosphatase regulator activity	protein amino acid dephosphorylation	calcineurin complex	calcineurin;	
PF14_0493	sortilin, putative	lipid transporter activity	endocytosis	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0494	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion		
PF14_0495	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0496	leucine-rich repeat protein 2, LRR2					
PF14_0497	hypothetical protein					
PF14_0498	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0499	hypothetical protein					
PF14_0500	hypothetical protein					
PF14_0501	hypothetical protein					
PF14_0502	hypothetical protein					
PF14_0503	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0504	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0505	hypothetical protein					
PF14_0506	hypothetical protein					
PF14_0507	hypothetical protein					
PF14_0508	pyridine nucleotide transhydrogenase, putative	NAD(P) transhydrogenase activity	biological_process	apicoplast, integral to membrane, membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0509	hypothetical protein					
PF14_0510	hypothetical protein				GGM tandem repeat protein;	
PF14_0511	glucose-6-phosphatedehydrogenase-6-phosphogluco no lactonase	6-phosphogluconolactonase activity, glucose-6-phosphate 1-dehydrogenase activity	glucose 6-phosphate utilization, pentose-phosphate shunt	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0512	hypothetical protein					
PF14_0513	RNA binding protein, putative	RNA binding	biological_process	cellular_component		
PF14_0514	tRNA intron endonuclease, putative	tRNA-intron endonuclease activity	tRNA splicing	tRNA-intron endonuclease complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0515	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0516	serine/threonine-protein kinase	protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0517	peptidase, putative	X-Pro aminopeptidase activity	proteolysis	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0518	nifU protein, putative	iron ion binding	iron ion homeostasis, iron-sulfur cluster assembly	mitochondrion		
PF14_0519	ribosomal protein S11, putative	structural constituent of ribosome	translation	mitochondrion, organellar small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0520	6-phosphogluconate dehydrogenase, decarboxylating, putative	phosphogluconate dehydrogenase (decarboxylating) activity	pentose-phosphate shunt	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0521	hypothetical protein					
PF14_0522	hypothetical protein					
PF14_0523	protein phosphatase 2C, putative	protein phosphatase type 2C activity	protein amino acid dephosphorylation	cellular_component		
PF14_0524	protein phosphatase 7 homolog, putative					
PF14_0525	hypothetical protein					
PF14_0526	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0527	hypothetical protein					
PF14_0528	hemolysin, putative	molecular_function	biological_process	membrane		
PF14_0529	gamma-adaptin, putative	molecular_function	intracellular protein transport	Golgi trans face, clathrin adaptor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0530	ferlin, putative	molecular_function	biological_process	membrane		
PF14_0531	hypothetical protein					
PF14_0532	hypothetical protein					
PF14_0791	dfg10 like protein, putative				annotation change, aeb, 070405, new gene model defined using SNAP	SNAP prediction, on sequence MAL14 score 6.654
PF14_0533	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0534	serine hydroxymethyltransferase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0535	hypothetical protein					
PF14_0536	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0537	hypothetical protein					
PF14_0538	hypothetical protein					
PF14_0539	hypothetical protein					
PF14_0540	hypothetical protein					
PF14_0541	V-type H(+)-translocating pyrophosphatase, putative	hydrogen ion transporter activity, hydrogen-translocating pyrophosphatase activity	regulation of pH	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0542	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0543	signal peptide peptidase, mSPP	molecular_function	biological_process	apicoplast, cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0544	hypothetical protein					
PF14_0545	thioredoxin	thiol-disulfide exchange intermediate activity	response to oxidative stress	cellular_component	PfTrx;	<b>attribution</b>:
PF14_0546	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0547	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0548	ATPase, putative	ATPase activity	intracellular protein transport	cellular_component		
PF14_0549	hypothetical protein					
PF14_0550	hypothetical protein					
PF14_0551	hypothetical protein				1 frameshift;	
PF14_0552	hypothetical protein	molecular_function	biological_process	membrane	1 frameshift;	
PF14_0553	cysteine proteinase falcipain-1	cysteine-type peptidase activity	hemoglobin catabolic process, proteolysis	membrane	gene-disruption showed this gene is is not essential in erythrocytic stage malaria. knock out parasites developed normally as the wild type.	<b>attribution</b>:
PF14_0554	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0555	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0556	hypothetical protein					
PF14_0557	hypothetical protein					
PF14_0558	hypothetical protein					
PF14_0559	hypothetical protein					
PF14_0560	hypothetical protein					
PF14_0561	hypothetical protein				2 frameshifts; NULL;	
PF14_0562	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0563	DEAD-box RNA helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component	1 frameshift;	
PF14_0564	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane, mitochondrion		
PF14_0565	hypothetical protein				1 frameshift;	
PF14_0566	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0567	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0568	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0569	hypothetical protein					
PF14_0570	pyridoxamine-phosphate oxidase	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0571	hypothetical protein					
PF14_0572	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0573	hypothetical protein					
PF14_0574	hypothetical protein					
PF14_0575	hypothetical protein					
PF14_0576	ubiquitin carboxyl-terminal hydrolase, putative	ubiquitin thiolesterase activity	ubiquitin-dependent protein catabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0577	hypothetical protein					
PF14_0578	hypothetical protein					
PF14_0579	ribosomal protein L27, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0580	hypothetical protein					
PF14_0581	ribosomal protein S10, putative	structural constituent of ribosome	translation	apicoplast, mitochondrion, plastid small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0582	hypothetical protein					
PF14_0583	hypothetical protein					
PF14_0584	ribosomal protein S4, putative	structural constituent of ribosome	translation	mitochondrial small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0585	ribosomal protein S28e, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0586	hypothetical protein					
PF14_0587	hypothetical protein					
PF14_0792	hypothetical protein, conserved				annotation change, aeb, 070405, new gene model defined using SNAP	SNAP prediction, on sequence MAL14 score 11.108
PF14_0588	hypothetical protein					
PF14_0589	valine - tRNA ligase, putative	valine-tRNA ligase activity	valyl-tRNA aminoacylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0590	hypothetical protein					
PF14_0591	hypothetical protein					
PF14_0592	hypothetical protein					
PF14_0593	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0594	hypothetical protein					
PF14_0595	hypothetical protein, conserved				annotation change, aeb, 070405, gene model modified after check of splice donor and acceptor sites. ExonI added. Confirmed by FASTA searches against UNIPROT	
PF14_0596	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0597	cytochrome c1 precursor, putative		electron transport	membrane, mitochondrion, respiratory chain complex III (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0598	glyceraldehyde-3-phosphate dehydrogenase	glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity	gluconeogenesis, glycolysis	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0599	hypothetical protein					
PF14_0600	hypothetical protein					
PF14_0601	replication factor C3		DNA replication, DNA strand elongation during DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0602	DNA polymerase alpha subunit, putative	alpha DNA polymerase activity	DNA replication, synthesis of RNA primer	alpha DNA polymerase:primase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0603	hypothetical protein					
PF14_0604	hypothetical protein					
PF14_0605	cyclin, putative	molecular_function	cell cycle, regulation of cyclin-dependent protein kinase activity	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0606	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0607	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0608	hypothetical protein					
PF14_0609	hypothetical protein					
PF14_0610	hypothetical protein					
PF14_0611	hypothetical protein					
PF14_0612	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0613	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0614	hypothetical protein					
PF14_0615	ATP synthase (C/AC39) subunit, putative		vacuolar acidification	hydrogen ion transporting ATPase V0 domain	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0616	i-AAA protease, putative	molecular_function	biological_process	apicoplast, cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0617	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0618	hypothetical protein					
PF14_0619	hypothetical protein					
PF14_0620	hypothetical protein					
PF14_0621	hypothetical protein					
PF14_0622	hypothetical protein	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0623	hypothetical protein					
PF14_0624	hypothetical protein					
PF14_0625	hypothetical protein	molecular_function	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0626	dynein beta chain, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0627	ribosomal protein S3, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0628	hypothetical protein					
PF14_0629	hypothetical protein					
PF14_0630	protein serine/threonine phosphatase	molecular_function	protein amino acid dephosphorylation	protein serine/threonine phosphatase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0631	hypothetical protein					
PF14_0632	26S proteasome subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0633	hypothetical protein				1 frameshift;	
PF14_0634	hypothetical protein					
PF14_0635	RNA binding protein, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0636	hypothetical protein					
PF14_0637	rhoptry protein, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0638	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0639	DNA-3-methyladenine glycosylase, putative	alkylbase DNA N-glycosylase activity	base-excision repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0640	hypothetical protein					
PF14_0641	1-deoxy-D-xylulose 5-phosphate reductoisomerase	1-deoxy-D-xylulose-5-phosphate reductoisomerase activity	isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0642	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0643	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0644	hypothetical protein					
PF14_0645	hypothetical protein					
PF14_0646	hypothetical protein					
PF14_0647	hypothetical protein					
PF14_0648	hypothetical protein					
PF14_0649	hypothetical protein					
PF14_0650	hypothetical protein					
PF14_0651	leucine-rich repeat protein, 14.2					
PF14_0652	hypothetical protein					
PF14_0653	hypothetical protein	molecular_function	biological_process	membrane	annotation change, aeb, 050405, annotation change, gene model modified, exonI added and exonII (formerly exonI) extended at the N-terminus	
PF14_0654	aminophospholipid transporting P_ATPase, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0655	RNA helicase-1, putative	ATP-dependent helicase activity, RNA cap binding, mRNA binding, translation initiation factor activity	regulation of translational initiation	eukaryotic translation initiation factor 4F complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0656	U2 snRNP auxiliary factor, putative	RNA binding	nuclear mRNA splicing, via spliceosome	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0657	hypothetical protein					
PF14_0658	translation initiation factor EF-1, putative	translation initiation factor activity	translational initiation	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0659	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0660	hypothetical protein					
PF14_0661	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0662	hypothetical protein	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0663	hypothetical protein					
PF14_0664	biotin carboxylase subunit of acetyl CoA carboxylase, putative	acetyl-CoA carboxylase activity, biotin binding, biotin carboxylase activity	fatty acid biosynthetic process	acetyl-CoA carboxylase complex, apicoplast, biotin carboxylase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0665	hypothetical protein					
PF14_0666	hypothetical protein					
PF14_0667	hypothetical protein					
PF14_0668	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0669	hypothetical protein					
PF14_0670	hypothetical protein					
PF14_0671	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0672	cyclic nucleotide phosphodiesterase, putative	3',5'-cyclic-nucleotide phosphodiesterase activity, cAMP binding	cyclic nucleotide metabolic process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0673	hypothetical protein					
PF14_0674	hypothetical protein					
PF14_0675	reticulocyte binding protein 2 homolog B, putative	molecular_function	biological_process	cellular_component	Reticulocyte Binding protein;	
PF14_0676	20S proteasome beta 4 subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0677	RNA 3'-Terminal Phosphate Cyclase-like protein, putative	molecular_function	ribosome biogenesis and assembly	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0678	exported protein 2	molecular_function	biological_process	parasitophorous vacuolar membrane	EXP-2;	
PF14_0679	inorganic anion exchanger, inorganic anion antiporter	sulfate porter activity	sulfate transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0680	hypothetical protein	molecular_function	biological_process	membrane	annotation change, aeb, 050405, gene model modified after TBLASTX comparison to P. knowlesi. Exons 3 and 4 defined. Formerly a 2 exon gene model	
PF14_0681	diacylglycerol kinase, putative	diacylglycerol kinase activity	protein kinase C activation, second-messenger-mediated signaling	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0682	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0683	hypothetical protein					
PF14_0684	hypothetical protein					
PF14_0685	hypothetical protein					
PF14_0686	hypothetical protein					
PF14_0687	hypothetical protein					
PF14_0688	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0689	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0690	histone deactylase, putative	histone deacetylase activity, protein binding	establishment and/or maintenance of chromatin architecture, regulation of transcription, DNA-dependent	histone deacetylase complex, membrane		
PF14_0691	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0692	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0693	hypothetical protein					
PF14_0694	protein disulfide isomerase, putative	protein disulfide isomerase activity	protein folding	endoplasmic reticulum	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0695	DNA-directed RNA polymerase, alpha subunit, truncated, putative	DNA-directed RNA polymerase activity	transcription, DNA-dependent	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0696	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0697	dihydroorotase, putative	dihydroorotase activity	'de novo' pyrimidine base biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0698	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0699	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0700	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0701	hypothetical protein					
PF14_0702	hypothetical protein					
PF14_0703	hypothetical protein					
PF14_0704	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0705	hypothetical protein					
PF14_0706	hypothetical protein					
PF14_0707	hypothetical protein					
PF14_0708	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0709	ribosomal protein L20, putative	structural constituent of ribosome	translation	mitochondrion, organellar large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0710	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0711	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0712	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0713	hypothetical protein					
PF14_0714	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF14_0715	hypothetical protein					
PF14_0716	Proteosome subunit alpha type 1, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0717	hypothetical protein					
PF14_0718	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF14_0719	hypothetical protein					
PF14_0720	hypothetical protein					
PF14_0721	cytochrome c oxidase assembly protein, putative	molecular_function	cytochrome c oxidase complex assembly	membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0722	hypothetical protein					
PF14_0723	hypothetical protein					
PF14_0724	hypothetical protein					
PF14_0725	tubulin, putative	structural molecule activity	microtubule-based movement	microtubule	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0726	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0727	hypothetical protein					
PF14_0728	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0729	early transcribed membrane protein 14.2, etramp14.2	molecular_function	biological_process	apicoplast, membrane	etramp14.2	Gene model was formerly shorter at the N-terminus. Characterisation of the ETRAMP gene family showed that the gene model should be extended at the N-terminus to allow an undisrupted signal peptide (PMID:12686607)
PF14_0730	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0731	hypothetical protein					
PF14_0732	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0733	protein kinase, FIKK family	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0734	protein kianse, FIKK family	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0735	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0736	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0737	lysophospholipase, putative	hydrolase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0738	lysophospholipase, putative	hydrolase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0739	hypothetical protein					
PF14_0740	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0741	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0742	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0743	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0744	hypothetical protein					
PF14_0745	hypothetical protein					
PF14_0746	hypothetical protein					
PF14_0747	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0748	hypothetical protein					
PF14_0749	acyl CoA binding protein	acyl carrier activity	fatty acid elongation	cellular_component		
PF14_0751	fatty acyl coenzyme A synthetase-1, putative	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process	host cell cytoplasm, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0752	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0753	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0754	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0755	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0756	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF14_0757	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0758	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0759	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0760	hypothetical protein					
PF14_0761	fatty acyl CoA synthetase 1	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process	host cell cytoplasm	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF14_0762	hypothetical protein	molecular_function	biological_process	apicoplast		
PF14_0763	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0764	hypothetical protein	molecular_function	biological_process	membrane		
PF14_0765	hypothetical protein					
PF14_0766	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0767	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PF14_0768	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0769	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0770	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0771	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PF14_0772	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF14_0773	erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0010w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0015c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0020c	erythrocyte membrane protein 1 (PfEMP1), truncated	molecular_function	biological_process	membrane	PfEMP1 fragment;	<b>attribution</b>:
PFB0025c	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PFB0030c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0035c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0040c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0045c	erythrocyte membrane protein 1 (PfEMP1), truncated				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0050c	stevor isoform gam beta	molecular_function	biological_process	Maurer's cleft, membrane		
PFB0055c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0056c	hypothetical protein					
PFB0060w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB0065w	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PFB0070w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0075c	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0080c	hypothetical protein	molecular_function	biological_process	membrane	RESA-like;	
PFB0085c	DnaJ protein, putative	molecular_function	biological_process	membrane	RESA-like;	
PFB0090c	DnaJ protein, putative	molecular_function	biological_process	cellular_component		
PFB0095c	erythrocyte membrane protein 3	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0100c	knob associated histidine-rich protein				KAHRP;	<b>attribution</b>:
PFB0105c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0106c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0110w	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0115w	hypothetical protein					
PFB0120w	early transcribed membrane protein 2, ETRAMP2	molecular_function	biological_process	apicoplast, membrane	PfSEP2	
PFB0125c	hypothetical protein					
PFB0130w	polyprenyl synthetase, putative	prenyltransferase activity	isoprenoid biosynthetic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0140w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0145c	hypothetical protein					
PFB0150c	protein kinase, putative	protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0160w	ERCC1 nucleotide excision repair protein, putative	damaged DNA binding, endodeoxyribonuclease activity	nucleotide-excision repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0161c	hypothetical protein, conserved					
1400.pre-tRNA-Gln-1	tRNA Glutamine					
PFB0170w	hypothetical protein, conserved	molecular_function	biological_process	membrane		
PFB0175c	Mak16 protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0177c	hypothetical protein				annotation change, aeb, 110405; gene model modified, gene models PFB0176c and PFB0177c joined. PFB0177c retained as unique identifier.	
PFB0180w	5'-3' exonuclease, N-terminal resolvase-like domain, putative	5'-3' exonuclease activity, DNA binding	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0185w	hypothetical protein, conserved					
PFB0190c	hypothetical protein					
PFB0194w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast		
PFB0195c	hypothetical protein					
PFB0200c	aspartate aminotransferase, putative	transaminase activity	amino acid metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0205c	5'-3' exonuclease, putative	molecular_function	biological_process	apicoplast		
PFB0210c	hexose transporter, PfHT1	monosaccharide transporter activity	monosaccharide transport	membrane	PfHT1	<b>attribution</b>:
PFB0215c	3'-5' exonuclease, putative	3'-5' exonuclease activity	biological_process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0220w	UbiE-like methlytransferase, putative	quinone cofactor methyltransferase activity	quinone cofactor biosynthetic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0225c	hypothetical protein					
PFB0230c	hypothetical protein					
PFB0235w	hypothetical protein					
PFB0240w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PFB0245c	DNA-directed RNA polymerase II 16 kDa subunit, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0250w	hypothetical protein					
PFB0255w	hypothetical protein, conserved					
PFB0257c	hypothetical protein, conserved				annotation change, aeb, 110405, gene model defined after TBLASTX comparison with P. knowlesi	
PFB0260w	proteasome 26S regulatory subunit, putative	molecular_function	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0265c	DNA repair endonuclease, putative	damaged DNA binding, endonuclease activity	DNA repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0270w	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, cellular_component, membrane		
PFB0275w	metabolite/drug transporter, putative	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0279w	hypothetical protein					
PFB0280w	hypothetical protein					
PFB0285c	hypothetical protein					
PFB0290c	transcription factor, putative	transcription factor activity	transcription from RNA polymerase III promoter	DNA-directed RNA polymerase III complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0295w	adenylosuccinate lyase, putative	adenylosuccinate lyase activity	purine nucleotide metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0300c	merozoite surface protein 2 precursor	molecular_function	biological_process	integral to membrane	MSP-2;	<b>attribution</b>:
PFB0305c	merozoite surface protein 5	molecular_function	biological_process	integral to membrane, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0310c	merozoite surface protein 4	molecular_function	biological_process	integral to membrane, membrane	MSP-4;	<b>attribution</b>:
PFB0315w	41 kDa antigen					
PFB0320c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, mitochondrion		
PFB0325c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0330c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0335c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0340c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0345c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0350c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0355c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	related to serine-repeat antigen (SERA);	<b>attribution</b>:
PFB0360c	cysteine protease, putative	cysteine-type peptidase activity	proteolysis	cellular_component	related to serine-repeat antigen (SERA);	<b>attribution</b>:
PFB0365w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PFB0370c	RNA-binding protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0375w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0380c	hypothetical protein	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0385w	acyl carrier protein, putative	molecular_function	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0390w	ribosome releasing factor, putative	molecular_function	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0391c	hypothetical protein					
PFB0395w	hypothetical protein	molecular_function	biological_process	apicoplast		
PFB0400w	Pfs45-48 related protein, putative	molecular_function	biological_process	apicoplast, membrane		
PFB0405w	transmission-blocking target antigen s230 precursor	metal ion binding, metalloendopeptidase activity	biological_process, pathogenesis, proteolysis	plasma membrane	PfS230;	
PFB0410c	phospholipase, putative	phospholipase activity	biological_process	cellular_component	patatin, putative;	<b>attribution</b>:
PFB0415c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0420w	2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity	terpenoid biosynthetic process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0425c	hypothetical protein					
PFB0435c	amino acid transporter, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0440c	hypothetical protein					
PFB0445c	helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0450w	Sec61-gamma subunit of protein translocation complex, putative	protein transporter activity	SRP-dependent cotranslational protein targeting to membrane, translocation	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0455w	ribosomal L37ae protein, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0460c	hypothetical protein					
PFB0465c	monocarboxylate transporter, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0467w	hypothetical protein, conserved				annotation channge, aeb, 110405, gene model defined after TBLASTX comparison with P. knowlesi	
PFB0470w	hypothetical protein					
PFB0475c	hypothetical protein, conserved					
PFB0480w	syntaxin, putative	molecular_function	vesicle-mediated transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0485c	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0490c	hypothetical protein					
PFB0495w	hypothetical protein					
PFB0500c	Rab5a, GTPase	GTPase activity	small GTPase mediated signal transduction	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0501c	hypothetical protein					
PFB0505c	beta-ketoacyl-acyl carrier protein synthase III precursor, putative	3-oxoacyl-[acyl-carrier-protein] synthase activity	fatty acid biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0510w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0515w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0520w	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0525w	asparagine -- tRNA ligase, putative	asparagine-tRNA ligase activity	asparaginyl-tRNA aminoacylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0530c	hypothetical protein					
PFB0535w	GDP-fructose:GMP antiporter, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0540w	hypothetical protein					
PFB0545c	ribosomal protein L7/L12, putative	structural constituent of ribosome	translation	apicoplast, cytosolic large ribosomal subunit (sensu the Bacteria research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0550w	peptide chain release factor subunit 1, putative	translation release factor activity	regulation of translational termination	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0555c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0560w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0570w	SPATR-like protein, putative	molecular_function	biological_process	apicoplast		
PFB0575c	hypothetical protein					
PFB0580w	MATE antiporter, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0585w	Leu/Phe-tRNA protein transferase, putative	catalytic activity	biological_process	cellular_component		
PFB0590w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0595w	heat shock 40 kDa protein, putative		response to heat, response to unfolded protein	cellular_component		
PFB0600c	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0605w	Ser/Thr protein kinase, putative	MAP kinase kinase activity	protein amino acid phosphorylation, signal transduction	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0610c	hypothetical protein					
PFB0615c	hypothetical protein					
PFB0620w	hypothetical protein					
PFB0625w	hypothetical protein					
PFB0630c	hypothetical protein					
PFB0635w	T-complex protein 1, putative	ATPase activity, coupled	protein folding	cellular_component		
PFB0640c	COPII-coated vesicle component, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0645c	Ribosomal protein L13, putative	structural constituent of ribosome	biological_process	cytosolic large ribosomal subunit (sensu the Bacteria research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0650w	hypothetical protein					
PFB0655c	hypothetical protein					
PFB0660w	hypothetical protein					
PFB0665w	Ser/Thr protein kinase, putative	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0670c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0675w	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0680w	hypothetical protein	molecular_function	biological_process	apicoplast		
PFB0685c	acyl-CoA synthetase, PfACS9	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process, long-chain fatty acid transport	apicoplast	No expression level was detected by PCR and RT-PCR for intraerythrocytic parasite GB:AAD10388.1: acyl-CoA ligase antigen {Plasmodium falciparum 3D7;}	<b>attribution</b>:
PFB0687c	RING zinc finger protein, putative				2 frameshifts;	
PFB0690w	hypothetical protein					
PFB0695c	acyl-CoA synthetase	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process, long-chain fatty acid transport	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0700c	hypothetical protein					
PFB0705w	hypothetical protein					
PFB0710c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0715w	DNA-directed RNA polymerase II second largest subunit, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0720c	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0725c	hypothetical protein	zinc ion binding	biological_process	apicoplast, membrane		
PFB0730w	DNA helicase, putative	DNA helicase activity, nonspecific RNA polymerase II transcription factor activity	chromatin remodeling	SWI/SNF complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0735c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0745w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0750w	vacuolar protein-sorting protein VPS45, putative	molecular_function	intracellular protein transport	cellular_component		
PFB0755w	hypothetical protein					
PFB0760w	MtN3-like protein, putative	molecular_function	biological_process	membrane		
PFB0765w	hypothetical protein					
PFB0770c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0775w	hypothetical protein					
PFB0790c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0795w	ATP synthase F1, alpha subunit, putative	molecular_function	biological_process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0800c	hypothetical protein					
PFB0805c	clathrin coat assembly protein, putative	molecular_function	intracellular protein transport	clathrin adaptor complex, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0810w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0814c	hypothetical protein	molecular_function	biological_process	apicoplast		
PFB0815w	Pf Calcium-dependent protein kinase 1	calcium ion binding, protein serine/threonine kinase activity	protein amino acid phosphorylation	cellular_component	PfCDPK1	<b>attribution</b>:
PFB0820c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0826c	hypothetical protein					
PFB0830w	Ribosomal protein S26e, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0835c	hypothetical protein					
PFB0840w	replication factor C, subunit 2		DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0845w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0855c	hypothetical protein	rRNA (guanine-N1-)-methyltransferase activity	ribosomal large subunit assembly and maintenance	apicoplast		
PFB0860c	RNA helicase, putative	ATP-dependent RNA helicase activity	biological_process	cellular_component		
PFB0865w	small nuclear ribonucleoprotein, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome		
PFB0870w	hypothetical protein					
PFB0875c	Chromatin-binding protein, putative	molecular_function	biological_process	nucleus		
PFB0877c	hypothetical protein				SNAP prediction, on sequence MAL2 score 31.546	annotation change, aeb, 101104; new gene model defined on the basis of a SNAP prediction
PFB0880w	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PFB0885w	40S ribosomal protein S30, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0886c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0888w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0890c	pseudouridine synthetase, putative	pseudouridylate synthase activity	rRNA modification	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0895c	replication factor C subunit 1, putative		DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0900c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0905c	hypothetical protein					
PFB0910w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0915w	liver stage antigen 3	molecular_function	biological_process	membrane	LSA-3;	
PFB0920w	DnaJ protein, putative	molecular_function	biological_process	membrane	RESA-like;	
PFB0921c	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0923c	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0925w	DnaJ protein, putative	molecular_function	biological_process	membrane	RESA-like:	
PFB0926c	hypothetical protein					
PFB0930w	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PFB0932w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0935w	cytoadherence linked asexual protein 2	cell adhesion molecule binding	cytoadherence to microvasculature, mediated by parasite protein	host cell plasma membrane	clag2;	<b>attribution</b>:
PFB0946c	hypothetical protein	molecular_function	biological_process	membrane		
PFB0950w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0951w	hypothetical protein, pseudogene				annotation change, aeb, 10112004; new gene model defined	
PFB0953w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0954c	hypothetical protein, conserved in P falciparum				annotation change, aeb, 10112004; new gene model defined on the basis of SNAP prediction and similarity data	
PFB1070w	hypothetical protein				annotation change, aeb, 10112004; gene model defined	
PFB0955w	stevor, degenerate, putative	molecular_function	biological_process	Maurer's cleft, membrane	1 frameshift;	
PFB0960c	Plasmdoium falciparum Maurer's Cleft 2 transmembrane domain protein 2.1, PfMC-2TM_2.1				PfMC-2TM_2.1	
PFB0965c	hypothetical protein					
PFB0970c	hypothetical protein					
PFB0972w	hypothetical protein					
PFB0973c	hypothetical protein					
PFB0974c	erythrocyte membrane protein 1 (PfEMP1), truncated, degenerate				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB0975c	erythrocyte membrane protein 1 (PfEMP1), truncated				1 frameshift; var; PfEMP1;	<b>attribution</b>:
PFB0976w	hypothetical protein	molecular_function	biological_process	membrane		
PFB0980w	hypothetical protein				RESA-like;	
PFB0985c	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 2.2, PfMC-2TM_2.2	molecular_function	biological_process	membrane	PfMC-2TM_2.2	
PFB0990c	hypothetical protein					
PFB0995w	hypothetical protein	molecular_function	biological_process	membrane		
PFB1000w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1005w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1010w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1015w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1020w	stevor, putative	molecular_function	biological_process	cellular_component, membrane		
PFB1025w	erythrocyte membrane protein 1 (PfEMP1), truncated, degenerate				1 frameshift; PfEMP1;	<b>attribution</b>:
PFB1030w	hypothetical protein				1 frameshift;	
PFB1035w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1040w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1045w	erythrocyte membrane protein 1 (PfEMP1), truncated				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFB1050w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PFB1055c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob, membrane	PfEMP1;	<b>attribution</b>:
PF10_0001	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	Pf EMP1;	<b>attribution</b>:
PF10_0002	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0003	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0004	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0005	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0006	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0007	hypothetical protein					
PF10_0008	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0009	pseudogene, stevor, putative				in-frame stop codon;	
PF10_0011	erythrocyte membrane protein 1 (PfEMP1), truncated, degenerate				PfEMP-1, truncated, degenerate;	<b>attribution</b>:
PF10_0012	erythrocyte membrane protein 1 (PfEMP1), truncated				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0013	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0014	hypothetical protein					
PF10_0015	acyl CoA binding protein, putative	acyl-CoA binding	fatty acid metabolic process	cellular_component		
PF10_0016	acyl CoA binding protein, putative	acyl-CoA binding	fatty acid metabolic process	cellular_component		
PF10_0017	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0018	hypothetical protein					
PF10_0019	early transcribed membrane protein 10.1, etramp 10.1	molecular_function	biological_process	cellular_component, membrane	etramp10.1	
PF10_0020	hypothetical protein					
PF10_0021	hypothetical protein					
PF10_0022	hypothetical protein					
PF10_0023	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0024	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0025	PF70 protein	molecular_function	biological_process	membrane		
PF10_0026	Tryptophan-rich antigen 3, putative	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0027	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0028	RNA binding protein, putative	molecular_function	biological_process	cellular_component		
PF10_0029	hypothetical protein					
PF10_0030	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0031	hypothetical protein					
PF10_0032	DnaJ protein, putative	molecular_function	biological_process	membrane		
PF10_0033	hypothetical protein					
PF10_0034	hypothetical protein					
PF10_0035	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0036	N-acetyltransferase, putative	N-acetyltransferase activity	biological_process	cellular_component		
PF10_0037	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0038	ribosomal protein S20e, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0039	hypothetical protein					
PF10_0040	hypothetical protein					
PF10_0041	U5 small nuclear ribonuclear protein, putative	GTPase activity, RNA splicing factor activity, transesterification mechanism	nuclear mRNA splicing, via spliceosome	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0042	hypothetical protein					
PF10_0043	ribosomal protein L13, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0044	hypothetical protein					
PF10_0045	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0046	hypothetical protein					
PF10_0047	RNA binding protein, putative					
PF10_0048	hypothetical protein					
PF10_0049	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0050	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0051	ADP/ATP carrier protein, putative	ATP:ADP antiporter activity		membrane, mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0052	hypothetical protein					
PF10_0053	tRNA ligase, putative	methionine-tRNA ligase activity	methionyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0054	hypothetical protein					
PF10_0055	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0056	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0057	regulator of nonsense transcripts, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0058	DnaJ protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0059	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0060	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0061	hypothetical protein					
PF10_0062	NOT protein, putative					
PF10_0063	DNA/RNA-binding protein, putative					
PF10_0064	hypothetical protein					
PF10_0065	hypothetical protein					
PF10_0066	hypothetical protein					
PF10_0067	hypothetical protein					
PF10_0068	RNA binding protein, putative					
PF10_0070	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0071	rhoGAP protein	Rho GTPase activator activity	Rho protein signal transduction	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0072	hypothetical protein					
PF10_0073	hypothetical protein					
PF10_0074	hypothetical protein					
PF10_0075	asparagine-rich antigen	molecular_function	biological_process	cellular_component		
PF10_0076	hypothetical protein					
PF10_0077	eukaryotictranslation initiation factor 3 subunit 7, putative	translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 3 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0078	histone deacetylase, putative					
PF10_0079	hypothetical protein					
PF10_0080	endonuclease, putative	molecular_function	biological_process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0081	26S proteasome regulatory subunit 4, putative	endopeptidase activity	proteolysis	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0082	hypothetical protein	molecular_function	biological_process	apicoplast	GB:AAN35280.1: hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0083	hypothetical protein					
PF10_0084	tubulin beta chain, putative	structural constituent of cytoskeleton	microtubule cytoskeleton organization and biogenesis	microtubule	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0085	nucleolar protein NOP5, putative	RNA binding	rRNA processing	cellular_component	NOP58, putative;	<b>attribution</b>:
PF10_0086	adenylate kinase, putative	adenylate kinase activity	biological_process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0087	diphthine synthase	diphthine synthase activity	biological_process	cellular_component		
PF10_0088	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0089	hypothetical protein					
PF10_0090	hypothetical protein					
PF10_0091	hypothetical protein					
PF10_0092	metallopeptidase, putative					
PF10_0093	hypothetical protein	molecular_function	biological_process	apicoplast	This gene is interupted by a region of uncertain sequence and is therefore inncomplete. Refer to MAL10.version2 for a previous version of this gene	
PF10_0094	tubulin-tyrosine ligase, putative					
PF10_0095	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0096	hypothetical protein					
PF10_0097	hypothetical protein					
PF10_0098	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0099	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0100	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0101	hypothetical protein					
PF10_0102	Ankyrin repeat protein, putative					
PF10_0103	eukaryotictranslation initiation factor 2, beta, putative	RNA binding, translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 2 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0104	hypothetical protein					
PF10_0105	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0106	hypothetical protein					
PF10_0107	hypothetical protein					
PF10_0108	hypothetical protein					
PF10_0109	hypothetical protein					
PF10_0110	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0111	20S proteasome beta subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0112	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0113	hypothetical protein					
PF10_0114	DNA repair protein RAD23, putative	damaged DNA binding	nucleotide-excision repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0115	QF122 antigen	molecular_function	biological_process	cellular_component		
PF10_0116	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0117	hypothetical protein					
PF10_0118	hypothetical protein					
PF10_0119	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0120	ubiquinol-cytochrome c reductase complex subunit, putative	molecular_function	biological_process	mitochondrion		
PF10_0121	hypoxanthine phosphoribosyltransferase	hypoxanthine phosphoribosyltransferase activity	purine ribonucleoside salvage	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0122	phosphoglucomutase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0123	GMP synthetase	GMP synthase activity	purine nucleotide biosynthetic process	cellular_component	2 frameshifts;	<b>attribution</b>:
PF10_0124	hypothetical protein					
PF10_0125	metabolite/vitamin transporter	molecular_function	biological_process	membrane		
PF10_0126	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF10_0127	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0128	WD repeat protein, putative					
PF10_0129	hypothetical protein					
PF10_0130	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0131	hypothetical protein					
PF10_0132	phospholipase C-like, putative	phosphoinositide phospholipase C activity, phospholipase C activity	intracellular signaling cascade, phospholipid metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0133	hypothetical protein					
PF10_0134	hypothetical protein					
PF10_0135	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0136	Initiation factor 2 subunit family, putative	translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 2B complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0137	GDP-fucose synthase, putative	oxidoreductase activity, racemase and epimerase activity, acting on carbohydrates and derivatives	nucleotide-sugar metabolic process, protein amino acid glycosylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0138	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0139	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0140	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0141	cdk7, putative	cyclin-dependent protein kinase activity	protein amino acid phosphorylation, regulation of progression through cell cycle	cellular_component	Pfmrk;	<b>attribution</b>:
PF10_0142	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0143	transcriptional activator ADA2, putative	transcription factor activity	regulation of transcription, DNA-dependent	membrane	homologue of the transcriptional coactivator ADA2; PfADA2;	
PF10_0144	prohibitin, putative	molecular_function	cellular process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0145	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0146	hypothetical protein					
PF10_0147	FAD synthetase, putative	FMN adenylyltransferase activity	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0148	hypothetical protein					
PF10_0149	cysteine -- tRNA ligase, putative	cysteine-tRNA ligase activity	cysteinyl-tRNA aminoacylation, translational elongation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0150	methionine aminopeptidase, putative	methionyl aminopeptidase activity	protein modification, proteolysis, regulation of translation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0151	hypothetical protein					
PF10_0152	hypothetical protein					
PF10_0153	hsp60	ATPase activity, coupled	protein folding, protein targeting to mitochondrion, response to unfolded protein	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0154	ribonucleotide reductase small subunit, putative	ribonucleoside-diphosphate reductase activity	DNA replication, deoxyribonucleoside diphosphate metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0155	enolase	phosphopyruvate hydratase activity	gluconeogenesis, glycolysis	phosphopyruvate hydratase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0156	hypothetical protein					
PF10_0157	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0158	hypothetical protein					
PF10_0159	glycophorin-binding protein 130 precursor	molecular_function	biological_process	host cell cytoplasm, membrane	GBP-130;	
PF10_0160	3.8 protein	molecular_function	biological_process	cellular_component, membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0161	hypothetical protein					
PF10_0162	hypothetical protein					
PF10_0163	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0164	early transcribed membrane protein 10.3, etramp10.3	molecular_function	biological_process	membrane	Gene prediction formerly had a second small exon. Characterisation of the ETRAMP gene family showed that this exon was incorrect (PMID:12686607)	
PF10_0165	DNA polymerase delta catalytic subunit	delta DNA polymerase activity, single-stranded DNA specific 3'-5' exodeoxyribonuclease activity	DNA replication	delta DNA polymerase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0166	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0167	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0168	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0169	phosphomannomutase, putative	phosphomannomutase activity	GDP-mannose biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0170	hypothetical protein					
PF10_0171	hypothetical protein					
PF10_0172	hypothetical protein					
PF10_0173	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0174	26s proteasome subunit p55, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0175	tRNA pseudouridine synthase, putative	pseudouridylate synthase activity	RNA processing	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0176	hypothetical protein					
PF10_0177	erythrocyte membrane-associated antigen	molecular_function	biological_process	cellular_component, membrane		
PF10_0178	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0179	PHF5-like protein, putative					
PF10_0180	hypothetical protein					
PF10_0181	hypothetical protein	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0182	hypothetical protein					
PF10_0183	hypothetical protein					
PF10_0184	hypothetical protein					
PF10_0185	hypothetical protein					
PF10_0186	hypothetical protein	molecular_function	biological_process	apicoplast	hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0187	ribosomal protein L30e, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0410	hypothetical protein				annotation change, aeb, 040405, new gene model defined on TBLASTX similarity with P knowlesi	
PF10_0188	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0189	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0190	hypothetical protein					
PF10_0191	tRNA methyltransferase, putative				hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0193	Autophagy protein, putative	molecular_function	biological_process	cellular_component		
PF10_0194	hypothetical protein					
PF10_0195	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0196	cytoplasmic dynein intermediate chain, putative	microtubule motor activity	microtubule-based movement	cytoplasmic dynein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0197	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0198	hypothetical protein					
PF10_0199	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0200	ATPase, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0407	dihydrolipoamide acetyltransferase, putative	molecular_function	biological_process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0203	ADP-ribosylation factor	GTP binding	intracellular protein transport, protein amino acid ADP-ribosylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0204	hypothetical protein					
PF10_0205	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0206	hypothetical protein					
PF10_0207	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0208	endomembrane protein 70, putative	molecular_function	biological_process	cellular_component, membrane		
PF10_0209	RNA helicase, putative	RNA helicase activity	biological_process	cellular_component		
PF10_0210	deoxyribose-phosphate aldolase, putative	deoxyribose-phosphate aldolase activity	pentose-phosphate shunt	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0211	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0212	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF10_0213	10b antigen, putative	molecular_function	biological_process	cellular_component		
PF10_0214	RNA binding protein, putative					
PF10_0215	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0216	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0217	pre-mRNA splicing factor, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	mitochondrion		
PF10_0218	citrate synthase, mitochondrial precursor, putative	citrate (Si)-synthase activity	citrate metabolic process, tricarboxylic acid cycle	mitochondrial matrix, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0219	hypothetical protein					
PF10_0220	hypothetical protein					
PF10_0221	GcpE protein	molecular_function	isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0222	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0223	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0224	dynein heavy chain, putative	microtubule motor activity, motor activity	microtubule-based process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0225	orotidine-monophosphate-decarboxylase, putative	orotidine-5'-phosphate decarboxylase activity	'de novo' pyrimidine base biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0226	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF10_0227	HORMA domain protein, putative	molecular_function	biological_process	cellular_component		
PF10_0228	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF10_0229	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF10_0230	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF10_0231	hypothetical protein					
PF10_0232	Chromodomain-helicase-DNA-binding protein 1 homolog, putative					
PF10_0233	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0234	hypothetical protein					
PF10_0235	RNA binding protein, putative					
PF10_0236	hypothetical protein					
PF10_0237	hypothetical protein					
PF10_0238	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0239	hypothetical protein					
PF10_0240	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0241	hypothetical protein					
PF10_0242	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0243	hypothetical protein					
PF10_0244	hypothetical protein					
PF10_0245	glucosamine--fructose-6-phosphate aminotransferase, putative	glutamine-fructose-6-phosphate transaminase (isomerizing) activity	glucosamine metabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0246	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0247	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0248	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0249	hypothetical protein					
PF10_0250	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0251	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0252	Cytochrome C oxidase copper chaperone, putative					
PF10_0253	hypothetical protein					
PF10_0254	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0255	hypothetical protein					
PF10_0256	hypothetical protein					
PF10_0257	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0258	hypothetical protein					
PF10_0259	hypothetical protein					
PF10_0260	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0261	WD repeat protein, putative					
PF10_0262	hypothetical protein					
PF10_0263	hypothetical protein					
PF10_0264	40S ribosomal protein, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0409	biotin--acetyl-CoA-carboxylase, putative				annotation change, aeb, 040405, new gene model	
PF10_0265	hypothetical protein					
PF10_0266	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0267	hypothetical protein					
PF10_0268	merozoite capping protein 1	oxidoreductase activity	entry into host cell	cellular_component	MCP;	
PF10_0269	DNA-directed RNA polymerase II, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0270	hypothetical protein					
PF10_0412	topoisomerase, putative				annotation change, aeb, 040405, new gene model defined on the basis of TBLASTX comparison with P. knowlesi	
PF10_0271	centrin, putative	calcium ion binding	biological_process	centrosome, membrane		
PF10_0272	ribosomal protein L3, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0273	DHHC-type zinc finger protein, putative	molecular_function	biological_process	membrane		
PF10_0274	hypothetical protein					
PF10_0275	protoporphyrinogen oxidase, putative	protoporphyrinogen oxidase activity	heme biosynthetic process, protoporphyrinogen IX biosynthetic process from glutamate	membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0276	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0277	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0278	BRIX domain containig protein, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0279	hypothetical protein					
PF10_0280	hypothetical protein					
PF10_0281	hypothetical protein	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0282	hypothetical protein					
PF10_0283	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0284	hypothetical protein					
PF10_0285	hypothetical protein					
PF10_0286	hypothetical protein					
PF10_0287	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0288	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0289	adenosine deaminase, putative	adenosine deaminase activity		cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0290	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0291	RAP protein, putative					
PF10_0292	hypothetical protein					
PF10_0293	transcription factor, putative	chromatin binding, transcription factor activity	transcription	cellular_component		
PF10_0294	RNA helicase, putative	ATP-dependent RNA helicase activity	RNA splicing	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0295	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0296	hypothetical protein					
PF10_0297	hypothetical protein					
PF10_0298	26S proteasome subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0299	glycoprotease, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0300	RNA methyltransferase, putative	molecular_function	biological_process	cellular_component		
PF10_0301	calmodulin, putative	calcium ion binding	biological_process	cellular_component		
PF10_0302	ookinete surface protein Pos28-1, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0303	25 kDa ookinete surface antigen precursor (pfs25)	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0304	hypothetical protein					
PF10_0305	hypothetical protein					
PF10_0306	MORN repeat containing protein					
PF10_0307	hypothetical protein					
PF10_0308	OTU-like cysteine protease, putative	molecular_function	biological_process	membrane		
PF10_0309	DEAD/DEAH box helicase, putative					
PF10_0310	hypothetical protein					
PF10_0311	protein phosphatase inhibitor, putative	molecular_function	biological_process	cellular_component		
PF10_0312	hypothetical protein					
PF10_0313	hypothetical protein	molecular_function	biological_process	apicoplast		
PF10_0314	asparagine-rich antigen	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0315	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0316	phosphatidyl inositol glycan, class A, putative	catalytic activity	GPI anchor biosynthetic process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0317	Der1-like family, putative	molecular_function	biological_process	membrane		
PF10_0318	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF10_0319	hypothetical protein					
PF10_0320	leucine-rich repeat protein 8, LRR8	molecular_function	biological_process	membrane		
PF10_0321	hypothetical protein					
PF10_0322	S-adenosylmethionine decarboxylase-ornithine decarboxylase	adenosylmethionine decarboxylase activity, ornithine decarboxylase activity	polyamine biosynthetic process, putrescine metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0323	early transcribed membrane protein 10.2, etramp 10.2	molecular_function	biological_process	membrane	etramp 10.2	
PF10_0324	hypothetical protein					
PF10_0325	haloacid dehalogenase-like hydrolase, putative	molecular_function	biological_process	cellular_component		
PF10_0326	WD repeat protein, putative					
PF10_0327	Myb2 protein	DNA binding	regulation of transcription, DNA-dependent	cellular_component		
PF10_0328	bromodomain protein, putative					
PF10_0329	aspartyl protease, putative	aspartic-type endopeptidase activity	proteolysis	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0330	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin-dependent protein catabolic process	cellular_component		
PF10_0331	Sec1 family protein, putative	molecular_function	biological_process	cellular_component		
PF10_0332	ribosomal protein L27, putative	structural constituent of ribosome	translation	apicoplast, membrane, plastid large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0333	hypothetical protein					
PF10_0334	flavoprotein subunit of succinate dehydrogenase	succinate dehydrogenase (ubiquinone) activity	tricarboxylic acid cycle	mitochondrion, respiratory chain complex II (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0335	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0336	hypothetical protein					
PF10_0337	ADP-ribosylation factor-like protein	GTP binding, transporter activity	intracellular protein transport	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0338	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0339	hypothetical protein					
PF10_0340	methionine -- tRNA ligase, putative	ATP binding, methionine-tRNA ligase activity	methionyl-tRNA aminoacylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0341	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF10_0342	hypothetical protein					
PF10_0343	S-antigen	molecular_function	biological_process	parasitophorous vacuole	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0344	glutamate-rich protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0345	merozoite surface protein 3	molecular_function	entry into host cell	cellular_component	MSP;	<b>attribution</b>:
PF10_0346	merozoite surface protein 6	molecular_function	entry into host cell	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0347	merozoite surface protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0348	Erythrocyte membrane protein, putative					
PF10_0349	hypothetical protein					
PF10_0350	hypothetical protein					
PF10_0351	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0352	merozoite surface protein, putative					
PF10_0353	hypothetical protein					
PF10_0354	hypothetical protein					
PF10_0355	Erythrocyte membrane protein, putative	molecular_function	biological_process	membrane		
PF10_0356	liver stage antigen-1	molecular_function	biological_process	cellular_component, membrane	PIR:S24597: liver stage antigen LSA-1 - malaria parasite (Plasmodium falciparum) {Plasmodium falciparum;} ^|^GB|CAA39663.1|9916|PFLSA1G liver stage antigen {Plasmodium falciparum;}	
PF10_0357	hypothetical protein					
PF10_0358	hypothetical protein					
PF10_0359	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0360	acetyl-coA transporter	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0361	hypothetical protein					
PF10_0362	DNA polymerase zeta catalytic subunit, putative	zeta DNA polymerase activity	DNA replication	membrane, zeta DNA polymerase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0363	pyruvate kinase, putative	pyruvate kinase activity	glycolysis	apicoplast, cytosol	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0364	hypothetical protein					
PF10_0365	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF10_0366	ADP/ATP transporter on adenylate translocase	ATP:ADP antiporter activity		membrane, mitochondrial inner membrane	NULL;	<b>attribution</b>:
PF10_0367	hypothetical protein				1 frameshift;	
PF10_0368	dynamin protein, putative	GTPase activity, microtubule motor activity	microtubule-based process, receptor-mediated endocytosis	microtubule associated complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0369	helicase, putative	DNA binding, damaged DNA binding, helicase activity	DNA repair	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0370	Enhancer of rudimentary homolog, putative					
PF10_0371	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0415	hypothetical protein, conserved				annotation change, aeb, 040405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF10_0372	Antigen UB05	molecular_function	biological_process	membrane		
PF10_0373	hypothetical protein					
PF10_0420	hypothetical protein				annotation change, aeb, 040405, new gene model defined after TBLASTX comparisom with P. knowlesi	
PF10_0374	Pf 11-1 protein	molecular_function	gametogenesis	cellular_component	Pf 11-1 protein {Plasmodium falciparum 3D7}	
PF10_0375	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0376	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0377	hypothetical protein	molecular_function	biological_process	membrane	1 frameshift;	
PF10_0378	DnaJ protein, putative	molecular_function	biological_process	membrane	RESA-like;	
PF10_0379	phospholipase, putative	hydrolase activity	metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0380	trophozoite antigen R45, putative	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF10_0381	DnaJ protein, putative	molecular_function	biological_process	membrane	RESA;	
PF10_0382	hypothetical protein					
PF10_0383	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	1 frameshift;	
PF10_0384	hypothetical protein					
PF10_0385	PfEMP-1, truncated, putative					
PF10_0386	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0387	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0388	hypothetical protein					
PF10_0389	hypothetical protein					
PF10_0390	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 10, PfMC-2TM_10	molecular_function	biological_process	membrane	PfMC-2TM_10	
PF10_0391	hypothetical protein					
PF10_0392	hypothetical protein	molecular_function	biological_process	membrane		
PF10_0393	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0394	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0395	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PF10_0396	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0397	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0398	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0399	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0400	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0401	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0402	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0403	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0404	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	rifin;	
PF10_0405	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF10_0406	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob, membrane	VAR	<b>attribution</b>:
PFD1250w	hypothetical protein, conserved in P falciparum				annotation change, aeb, 111104, new gene model defined on the basis of SNAP gene prediction and FASTA similarity to PF11_0004	
PFD1245c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1240w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD1235w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
PFD1230c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD1200w	RIF pseudogene, RIFIN pseudogene				RIF, pseudogene	RIF pseudogene fragment. The first 25 aa amino acids are missing to obtain usual rifin gene structure. Thus, it is a possibble rifin pseudogene; possibility exits of a truncated rifin protein being coded, 274 aa in length using the first internal methionine codon as the start codon
PFD1220c	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.941, signal anchor probability 0.000) with cleavage site probability 0.876 between residues 19 and 20	stevor
PFD1215w	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	
PFD1210w	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	
PFD1205w	hypothetical integral membrane protein,conserved in P. falciparum				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.988, signal anchor probability 0.000) with cleavage site probability 0.910 between residues 19 and 20	Obsolete product name: hypothetical integral membrane protein, conserved in P. falciparum
PFD1200c	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.608, signal anchor probability 0.002) with cleavage site probability 0.259 between residues 18 and 19
PFD1195c	hypothetical protein			apicoplast	Obsolete product name: hypothetical protein	
PFD1190c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD1185w	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	
PFD1180w	trophozoite antigen r45-like protein,truncated				Obsolete product name: Plasmodium falciparum trophozoite antigen r45-like protein, truncated	Similar to Plasmodium falciparum trophozoite antigen r45; truncated
PFD1175w	Plasmodium falciparum trophozoite antigen r45-like protein			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1170c	RESA-like protein, truncated				Similar to N-terminal region of Plasmodium falciparum ring-infected erythrocyte surface antigen precursor RESA	Obsolete product name: Plasmodium falciparum RESA-like protein, truncated
PFD1165w	FIKK protein kinase	protein kinase activity	protein amino acid phosphorylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1160w	surface-associated interspersed gene 4.2, (SURFIN4.2)				3D7Surf4.2	
PFD1155w	erythrocyte binding antigen-165	binding			Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.916, signal anchor probability 0.000) with cleavage site probability 0.576 between residues 21 and 22	<b>attribution</b>:
PFD1150c	reticulocyte binding protein homolog 4, Rh4				260607, annotation change, gene model changed by addition of exon 1. Evidence from via cDNA sequencing, Kaneko et. al.  (PMID:12034462)	<b>attribution</b>:
PFD1145c	reticulocyte binding protein homolog 5, Rh5				Rh5	<b>attribution</b>:
PFD1140w	hypothetical protein, conserved in P.falciparum				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.050, signal anchor probability 0.950) with cleavage site probability 0.039 between residues 27 and 28	Obsolete product name: hypothetical protein
PFD1135c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD1130w	hypothetical protein, conserved				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.869, signal anchor probability 0.128) with cleavage site probability 0.514 between residues 25 and 26	Obsolete product name: hypothetical protein
PFD1120c	early transcribed membrane protein 4, ETRAMP4			membrane	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.896, signal anchor probability 0.030) with cleavage site probability 0.297 between residues 22 and 23	
PFD1115c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD1110w	hypothetical membrane protein, conserved				Possibilities exit for 2 exons forming 2 separate hypothetical proteins	Obsolete product name: hypothetical protein
PFD1105w	hypothetical protein				Obsolete product name: hypothetical protein	
PFD1100c	hypothetical protein, conserved			apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.010, signal anchor probability 0.736) with cleavage site probability 0.003 between residues 36 and 37	Obsolete product name: hypothetical protein
PFD1095w	BSD-domain protein, putative				annotation is based on pfam match	Obsolete product name: hypothetical protein
PFD1090c	clathrin assembly protein, putative		vesicle-mediated transport	secretory granule, transport vesicle	Similarity to clathrin assembly proteins or adapter-related proteins	<b>attribution</b>:
PFD1085w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD1080w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD1045w	hypothetical membrane protein, conserved				Obsolete product name: hypothetical protein	The last exon is uncertain; Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.043, signal anchor probability 0.694) with cleavage site probability 0.020 between residues 24 and 25
PFD1070w	eukaryotic initiation factor, putative	ATP-dependent RNA helicase activity, translation initiation factor activity	regulation of translational initiation	eukaryotic translation initiation factor 4F complex	Similar to several eukaryotictranslation initiation factors	Obsolete product name: putative eukaryotictranslation initiation factor
PFD1065c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD1060w	u5 small nuclear ribonucleoprotein-specific protein, putative	ATP-dependent RNA helicase activity, RNA splicing factor activity, transesterification mechanism		spliceosome	Obsolete product name: putative snRNP-like helicase	<b>attribution</b>:
PFD1055w	ribosomal protein S19s, putative	structural constituent of ribosome	translation	ribosome	Similarity to several 40S ribosomal protein s19	<b>attribution</b>:
PFD1050w	alpha-tubulin ii	structural molecule activity	microtubule-based movement	microtubule	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1045c	erythrocyte membrane-associated antigen, putative				Obsolete product name: putative erythrocyte membrane-associated antigen	Similar to Plasmodium falciparum erythrocyte membrane-associated antigen SWALL:Q9GVB6 (EMBL:X53015) fragment sequence; annotation based on published sequence data;PMID: 1896607;
PFD1015w	hypothetical protein, conserved				Asparagine-rich protein	
PFD1035w	steroid dehydrogenase kik-i, putative	oxidoreductase activity	fatty acid biosynthetic process		Similarity to mouse steroid dehydrogenase kik-i and several b-keto acyl reductases from plants	Obsolete product name: putative b-keto acyl reductase
PFD1007w	hypothetical protein					
PFD1006w	hypothetical protein					
PFD1030c	hypothetical protein, conserved				Weak similarity to Plasmodium falciparum; hypothetical 202.1 kDa protein (SWALL:O77322 (EMBL:Z98547))	Obsolete product name: hypothetical protein
PFD1004c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD1025w	erythrocyte membrane protein 1 (PfEMP1)-like pseudogene				VAR pseudogene	pseudogene; VAR-like fragment
PFD1020c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD1015c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1010w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFD1005c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD1000c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	Obsolete product name: pfEMP1
PFD0995c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	VAR
PFD0993c	hypothetical protein, conserved				annotation change, aeb, 110405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFD0990w	ribosome recycling factor, putative		regulation of translation		Obsolete product name: putative ribosome recycling factor	Similarity to several prokaryotic ribosome recycling factors; with large N-terminal extension
PFD0985w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0980w	holo-(acyl-carrier protein) synthase, putative	transferase activity	fatty acid biosynthetic process	apicoplast	Putative acyl-carrier protein with long N-terminal extension; C-terminal similarity to holo-[acyl-carrier protein] synthase proteins of bacterial origin	<b>attribution</b>:
PFD0975w	ROI kinase-like protein				Similar to (SWALL:Q9BVS4 (EMBL:BC000953)) Homo sapiens hypothetical 63.3 kDa protein and to Schizosaccharomyces pombe conserved hypothetical protein spbc1703.05 (SWALL:Q9VBU2 (EMBL:AL136536))	<b>attribution</b>:
PFD0970c	Zinc finger, putative				Obsolete product name: hypothetical protein	<b>attribution</b>:
PFD0965W	putative phosphatidylinositol 4-kinase, frameshifted				There is a frameshift in the current model; Frameshifted P. falciparum phosphatidylinositol 4-kinase; annotation based on blastp results and pfam match	renamed from PFD0940w due to gene name duplication
PFD0960c	ribosomal protein L7Ae-related protein, putative	structural constituent of ribosome	translation	ribosome	Obsolete product name: putative ribosomal protein L7Ae-related protein	
PFD0955w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0950w	ran binding protein 1	GTP binding, GTPase activity	DNA replication		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0945c	hypothetical membrane protein, conserved				Obsolete product name: hypothetical protein	
PFD0940w	hypothetical protein, conserved				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.924, signal anchor probability 0.076) with cleavage site probability 0.731 between residues 25 and 26	Obsolete product name: hypothetical protein
PFD0935c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0930w	CGI-141 protein homolog, putative				Obsolete product name: Homologue of human CGI-141 protein	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.115, signal anchor probability 0.885) with cleavage site probability 0.060 between residues 23 and 24
PFD0925w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0920w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0915w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0910w	hypothetical protein, conserved				Possible 3' exon(s) could exist as evidenced from GC-plot and proteomics data (source: M. Mann)	Obsolete product name: hypothetical protein
PFD0905w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0900w	hypothetical protein, conserved				Weakly similar to several hypothetical proteins of P. falciparum; very weak hits to regulator of chromosome condensation (RCC1) profile	Obsolete product name: hypothetical protein
PFD0895c	Bet3 transport protein, putative	transporter activity	ER to Golgi vesicle-mediated transport		Similar to several Bet3 proteins	Obsolete product name: putative Bet3 homolog
PFD0890w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0885c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	Weak hits to several hypothetical proteins of P. falciparum
PFD0880w	hypothetical protein, conserved				C-terminal domain similarity to a homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins. This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Apparently, all of the characterized proteins containing PCI domains are parts of larger multi-protein complexes.	Obsolete product name: hypothetical protein
PFD0875c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0872w	hypothetical protein, conserved				renamed from PFD0846w due to duplication of gene name	Additional 2 small exons possible at C-terminal end
PFD0870w	hypothetical protein, conserved				renamed from PFD0845w due to gene name duplication	
PFD0865c	cdc2-related protein kinase 1	ATP binding, protein kinase activity	protein amino acid phosphorylation		Obsolete product name: cdc2-related protein kinase 1	Pfcrk-1
PFD0860w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	annotation change, 111104, gene model modified on the basis of comparison of regions of conserved synteny with P. knowlesi and P yoelii, and using the SNAP prediction algorithm
PFD0855c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0850c	hypothetical protein, conserved				renamed from PFD0825c due to duplication of gene name	annotation change, aeb, 111104, gene model modified. Coordinates of exon 2 changed on the basis of comparison of region of conserved synteny with P. knowlesi and P.yoelii
PFD0840w	hypothetical protein, conserved				gene prediction revised: PFD0840w and PFD0845w merged. Gene name PFD0845w (and synonym MAL4P1.164) made obsolete	
PFD0835c	LETM1-like protein, putative			apicoplast	Obsolete product name: hypothetical protein	annotation is based on pfam match
PFD0830w	bifunctional dihydrofolate reductase-thymidylate synthase	dihydrofolate reductase activity, thymidylate synthase activity	dTMP biosynthetic process, glycine biosynthetic process, nucleotide biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0825c	RNA-binding protein of pumilio/mpt5 family, putative	RNA binding	negative regulation of protein biosynthetic process		Obsolete product name: putative RNA-binding protein of pumilio / mpt5 family	Similarity to several pumilio/mpt5 family RNA-binding proteins of plant origin
PFD0820w	hypothetical protein, conserved			apicoplast	Obsolete product name: hypothetical protein	
PFD0815c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0810w	small GTP-binding protein sar1	GTP binding	intracellular protein transport		sar1	<b>attribution</b>:
PFD0805w	prohibitin-like protein, putative				Obsolete product name: Putative prohibitin-like protein	Several weak hits to plant prohibitins
PFD0800c	hypothetical protein, conserved				asparagine-rich protein	Obsolete product name: hypothetical protein
PFD0795w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	Not certain about existence of the the last 2 exons
PFD0790c	DNA replication licensing factor, putative	DNA-dependent ATPase activity	DNA replication initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0785c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0780w	glutamyl-tRNA(Gln) amidotransferase subunit A, putative	glutamyl-tRNA(Gln) amidotransferase activity		apicoplast	Similar to glutamyl-trnagln amidotransferase subunit a from several bacteria	Obsolete product name: putative glutamyl-trna amidotransferase
PFD0775c	hypothetical RNA binding protein	RNA binding			Obsolete product name: hypothetical RNA binding protein	
PFD0770c	ribosomal protein l15, putative	structural constituent of ribosome	translation	ribosome	renamed from PFD0745c due to duplication of gene name	<b>attribution</b>:
PFD0765w	RING finger protein, putative	zinc ion binding			Contains RING finger motif	Obsolete product name: hypothetical protein with RING finger domain
PFD0760c	hypothetical protein, conserved			apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.013, signal anchor probability 0.968) with cleavage site probability 0.010 between residues 24 and 25	Obsolete product name: hypothetical protein
PFD0755c	adenylate kinase 1	adenylate kinase activity	nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0750w	nuclear cap-binding protein, putative	RNA cap binding	mRNA processing	snRNA cap binding complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0745c	nonclathrin coat protein zeta2-cop-related protein, putative		intracellular protein transport	COPI vesicle coat	Similarities to several nonclathrin coat protein zeta2-cop-related proteins	Obsolete product name: putative nonclathrin coat protein zeta2-cop-related protein
PFD0740w	Plasmodium falciparum protein kinase, putative	protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0711c	hypothetical protein					
PFD0735c	hypothetical protein, conserved				Nearly identical to Plasmodium falciparum malaria antigen fragment (SWALL:Q25905 (EMBL:M63269)) in the N-terminal region	Obsolete product name: hypothetical protein
PFD0730w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0725c	arsenical pump-driving ATPase, putative	arsenite-transporting ATPase activity	ion transport	membrane	Similar to several arsenical pump-driving ATPases	Obsolete product name: putative arsenite-transporting ATPase
PFD0720w	hypothetical protein, conserved				Obsolete product name: hypothetical protein with beta-catenin-like repeats	Contains beta-catenin-like repeats
PFD0715c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0710w	GTP-binding protein, putative	GTP binding		apicoplast	Obsolete product name: hypothetical GTP-binding protein	
PFD0705c	hypothetical protein, conserved				Obsolete product name: hypothetical protein with pleckstrin homology (PH) domain	Contains pleckstrin homology (PH) domain
PFD0700c	RNA binding protein, putative	nucleic acid binding	RNA metabolic process		Obsolete product name: putative RNA binding protein	gene name changed from PFD0675c due to duplication
PFD0695w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0669c	hypothetical protein, conserved				annotation change, aeb, 121104, gene model modified exon 4 added	annotation change, aeb, 111104, new gene model defined on the basis of comparison of conserved synteny to P. knowlesi;
PFD0692c	hypothetical protein, conserved				SNAP prediction, on sequence MAL4 score 10.915	annotation change, aeb, 111104, new gene model defined.
PFD0690c	hypothetical protein, conserved			apicoplast	Obsolete product name: hypothetical protein	Alternative splicing model is possible at the C-terminus
PFD0685c	chromosome associated protein, putative	ATP binding	chromosome organization and biogenesis (sensu the Eukaryota research community)	nuclear chromosome	Obsolete product name: putative chromosome associated protein, SMC family	Similarity to several chromosome associated proteins, belonging to SMC superfamily
PFD0655c	ubiquitin carboxyl-terminal hydrolase a, putative	ubiquitin thiolesterase activity	ubiquitin-dependent protein catabolic process	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0675w	ribosomal protein l10, putative	structural constituent of ribosome		apicoplast, ribosome	Weakly related to several chloroplast ribosomal protein l10; there is possibility of another small exon at the C-terminus	Obsolete product name: putative ribosomal protein l10
PFD0670c	lysine decarboxylase-like protein, putative				Obsolete product name: conserved hypothetical protein	
PFD0665c	26s proteasome aaa-ATPase subunit Rpt3, putative	ATPase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0660w	phosphoglycerate mutase, putative	phosphoglycerate mutase activity	glycolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0655w	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR, pseudogene	
PFD0650w	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0645w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Signal peptide predicted for mal1p4.07 by SignalP 2.0 HMM (Signal peptide probabilty 0.895, signal anchor probability 0.008) with cleavage site probability 0.389 between residues 24 and 25	RIF
PFD0640c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD0635c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0630c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	Obsolete product name: pfEMP1	VAR
PFD0625c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0595c	rifin, truncated	molecular_function	biological_process		RIF truncated	Truncated at C-terminal end
PFD0615c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)
PFD0610w	hypothetical protein, conserved				Conserved residues at the N-terminal end of the protein	Obsolete product name: conserved hypothetical protein
PFD0605c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0600c	ribosomal protein, putative	structural constituent of ribosome	translation	small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0595w	hypothetical protein, conserved				Slightly different from the submitted sequence (SWALL:Q9U0H0 (EMBL:AL035475)); ~14 amino acids are not present in the present gene model than that of the submitted sequence	Obsolete product name: hypothetical protein
PFD0590c	DNA polymerase alpha	3'-5' exonuclease activity, DNA-directed DNA polymerase activity	DNA replication		Obsolete product name: DNA polymerase alpha	<b>attribution</b>:
PFD0585c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0580c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
MAL4_tRNA_Glu1	tRNA Glutamine				tRNA Glu anticodon CTC, Cove score 69.26	
MAL4_tRNA_Ala1	tRNA Alanine				tRNA Ala anticodon TGC, Cove score 71.66	
PFD0565c	RNA helicase, putative	ATP-dependent RNA helicase activity	RNA metabolic process		Obsolete product name: putative RNA helicase	Originally annotated as hypothetical 156.6 kDa protein
PFD0560w	hypothetical protein, conserved				renamed from PFD0545w due to duplication of gene names	
PFD0555c	hypothetical protein, conserved			apicoplast	Obsolete product name: hypothetical protein	Signal peptide predicted for mal4p2.46 by SignalP 2.0 HMM (Signal peptide probabilty 0.901, signal anchor probability 0.093) with cleavage site probability 0.405 between residues 19 and 20
PFD0550c	hypothetical protein, conserved				Obsolete product name: hypothetical 24.0 kDa protein	renamed from PFD0535c due to duplication of gene name
PFD0545w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0540c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0535w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0530c	Hypothetical protein, conserved	GTP binding		apicoplast	Obsolete product name: Hypothetical protein	Signal peptide predicted for mal4p2.41 by SignalP 2.0 HMM (Signal peptide probabilty 0.911, signal anchor probability 0.001) with cleavage site probability 0.388 between residues 17 and 18
PFD0525w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0520c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0515w	exosome complex exonuclease rrp4, putative	3'-5'-exoribonuclease activity	rRNA processing	exosome (RNase complex)	Putative exosome complex exonuclease rrp4; previously annotated as P. falciparum conserved hypothetical protein TR:Q9U0I4 (EMBL:AL035475); Plasmodium falciparum	Obsolete product name: hypothetical protein, conserved
PFD0505c	protein phosphatase 2C	phosphoprotein phosphatase activity	protein amino acid dephosphorylation		renamed from PFD0495c due to duplication of gene name	Alternative exon structure possible at the C-terminal end of the protein
MAL4_tRNA_Ile1	tRNA Isoleucine				tRNA Ile anticodon TAT, Cove score 79.22	
MAL4_tRNA_Ser1	tRNA Serine				tRNA Ser anticodon AGA, Cove score 65.52	
PFD0495c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0487c	actin-like protein, putative	structural constituent of cytoskeleton	cytoskeleton organization and biogenesis	actin cytoskeleton	Previously annotated as Plasmodium falciparum hypothetical 46.9 kDa protein; TR:Q9U0I7 (EMBL:AL035475); Gene model also changed from the earlier version as new 5' exons incorporated in the new model as compared to the submitted sequence TR:Q9U0I7 (EMBL:AL035475)	gene name changed from PFD0485c due to duplication
PFD0485w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0480w	hypothetical protein, conserved			apicoplast	Obsolete product name: hypothetical protein	First exon is uncertain; alternative possibility is the first ATG codon in the exon II in this gene model; Signal peptide predicted for mal4p2.33 by SignalP 2.0 HMM (Signal peptide probabilty 0.840, signal anchor probability 0.000) with cleavage site probability 0.292 between residues 21 and 22
PFD0470c	replication factor a protein, putative		DNA replication, DNA-dependent DNA replication	DNA replication factor A complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0466c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0465c	hypothetical protein, conserved				Signal anchor predicted for mal4p2.31 by SignalP 2.0 HMM (Signal peptide probabilty 0.006, signal anchor probability 0.798) with cleavage site probability 0.002 between residues 23 and 24	<b>attribution</b>:
PFD0462w	DNAJ protein	unfolded protein binding	response to heat	apicoplast	gene name changed from PFD0465w due to duplication	
PFD0460c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0455w	ribosomal processing protein, putative		rRNA modification	small nucleolar ribonucleoprotein complex	P. falciparum homologue of yeast SOF1 protein	<b>attribution</b>:
PFD0450c	pre-mrna splicing factor, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome	Obsolete product name: putative pre-mrna splicing factor	Formerly annotated as Plasmodium falciparum conserved hypothetical protein; Mal4p2.27. TR:Q9U0J5 (EMBL:AL035475)
PFD0445c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0440w	peptidase, M22 family, putative				Signal anchor predicted for mal4p2.25 by SignalP 2.0 HMM (Signal peptide probabilty 0.067, signal anchor probability 0.791) with cleavage site probability 0.052 between residues 25 and 26	putative glycoprotease assignment removed as pfam domain had been removed:02-03-04:AEB
PFD0435c	hypothetical protein, conserved				Obsolete product name: hypothetical 37.4 KDa protein	Signal peptide predicted for mal4p2.24 by SignalP 2.0 HMM (Signal peptide probabilty 0.786, signal anchor probability 0.000) with cleavage site probability 0.363 between residues 21 and 22
PFD0430c	MAC/Perforin, putative			apicoplast	Obsolete product name: hypothetical protein with possible perforin-like domain	
PFD0425w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	Signal peptide predicted for mal4p2.22 by SignalP 2.0 HMM (Signal peptide probabilty 0.996, signal anchor probability 0.000) with cleavage site probability 0.764 between residues 21 and 22
PFD0420c	flap exonuclease, putative	endodeoxyribonuclease activity	DNA metabolic process		Obsolete product name: putative flap endonuclease	Similarity to several flap endonucleases
PFD0415c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0405c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0403w	hypothetical protein, conserved				renamed from PFD0405w due to duplication of gene name	Obsolete product name: hypothetical protein
PFD0400w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	annotation change, aeb, 121104, gene model modified, intron defined after MET246 resulting in the loss of 29 amino from the predicted protein sequence
PFD0395c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0385c	AAA family ATPase, putative	ATPase activity			Originally annotated as a Plasmodium falciparum hypothetical 77.8 kDa protein SWALL:Q9U0K7 (EMBL:AL035475) present annotation based on high degree of similarity to AAA ATPases domains in HMMpfam and HMMSMART hits and results of fasta / blastp similarity searches	Obsolete product name: putative AAA family ATPase
PFD0385w	hypothetical protein, conserved					
PFD0380c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0375w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0367w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0365c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0360w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0355c	Peptidyl-tRNA hydrolase PTH2, putative				Signal anchor predicted for mal4p2.08 by SignalP 2.0 HMM (Signal peptide probabilty 0.002, signal anchor probability 0.876) with cleavage site probability 0.001 between residues 32 and 33	Obsolete product name: conserved hypothetical protein
PFD0350w	hypothetical protein, conserved				Obsolete product name: conserved hypothetical protein	
PFD0345c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0340c	hypothetical protein, conserved				Alternative start site possible; gene model slightly modified from submitted version (SWALL:Q9U0L7 (EMBL:AL035475)) Plasmodium falciparum hypothetical 205.8 kDa protein sequence	Obsolete product name: hypothetical protein
PFD0335c	hypothetical protein, conserved				Obsolete product name: hypothetical 33.9 kDa protein	
PFD0330w	hypothetical protein, conserved				There is slight modification in the gene model in the last exon from submitted (SWALL:Q9U0L9 (EMBL:AL035475)) Plasmodium falciparum hypothetical 103.2 kDa protein sequence	Obsolete product name: hypothetical 103.2 kDa protein
PFD0325w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0320c	hypothetical protein, conserved				Obsolete product name: hypothetical 136.1 kDa protein	Possible distant homologue of reticulocyte binding proteins of P. falciparum
PFD0311w	hydroxyacyl glutathione hydrolase, putative	hydroxyacylglutathione hydrolase activity	lactate metabolic process		Similar to several hydroxyacyl glutathione hydrolases	
PFD0315c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0310w	sexual stage-specific protein precursor				Signal peptide predicted for sexual stage-specific protein precursor by SignalP 2.0 HMM (Signal peptide probabilty 0.995, signal anchor probability 0.004) with cleavage site probability 0.896 between residues 25 and 26.	Obsolete product name: sexual stage-specific protein precursor
PFD0305c	vacuolar ATP synthase subunit b	hydrogen ion transporting ATPase activity, rotational mechanism	vacuolar acidification		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0300w	hypothetical protein, conserved				Weak similarity to Plasmodium falciparum; Pfc0405C protein	
PFD0295c	apical sushi protein, ASP				Weak similarity to Plasmodium falciparum; hypothetical 78.6 kDa protein. 1 probable transmembrane helix predicted by TMHMM2.0 at aa 712-729	<b>attribution</b>:
PFD0290w	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0285c	lysine decarboxylase, putative	lysine decarboxylase activity	lysine catabolic process		Obsolete product name: amino acid decarboxylase, putative	Similar to several bacterial lysine decarboxylases
PFD0280w	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0275w	secy-independent transporter protein, putative				4 probable transmembrane helices predicted by TMHMM2.0 at aa 89-111, 121-139, 174-193 and 221-243	Obsolete product name: hypothetical protein
PFD0270c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0265w	pre-mRNA splicing factor, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome	Similarities to several pre-mRNA splicing factor	Obsolete product name: pre-mRNA splicing factor, putative
PFD0260c	sequestrin	cell adhesion molecule binding	cytoadherence to microvasculature, mediated by parasite protein	plasma membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0255w	ag-1 blood stage membrane protein homologue				Similar to P. yoelii blood stage membrane protein ag-1	Obsolete product name: ag-1 blood stage membrane protein homologue
PFD0250c	Sec24-like protein, putative				Obsolete product name: hypothetical protein	
PFD0245c	ATP-dependent RNA helicae-like protein, putative	ATP-dependent RNA helicase activity	RNA metabolic process		Obsolete product name: ATP-dependent RNA helicase-like protein, putative	
PFD0240c	pfs45-48 related protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0235c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.994, signal anchor probability 0.000) with cleavage site probability 0.264 between residues 17 and 18
PFD0230c	protease, putative	cysteine-type peptidase activity	protein catabolic process	apicoplast	Obsolete product name: cysteine protease, putative	Contains putative signal peptide; HMMSmart hit Pept_C1 and HMMpfam hit peptidase_C1; BLAST with domain does hit to several proteases
PFD0225w	hypothetical protein, conserved				Hypothetical asparagine-rich protein; there is possibility of having 1 or 2 small introns in this large protein. 4 probable transmembrane helices predicted by TMHMM2.0 at aa 1820-1842, 2314-2336, 3399-3416 and 3437-3459	Obsolete product name: hypothetical asparagine-rich protein
PFD0215c	pf52 protein				2 probable transmembrane helices predicted by TMHMM2.0 at aa 12-34 and 451-468; Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.053, signal anchor probability 0.880) with cleavage site probability 0.022 between residues 28 and 29.	<b>attribution</b>:
PFD0210c	pbs36 homologue				Obsolete product name: pbs36-related protein	Similar to P. berghei pbs36 protein. 1 probable transmembrane helix predicted by TMHMM2.0 at aa 24-46.
PFD0207c	hypothetical protein, conserved			apicoplast	Obsolete product name: hypothetical protein	Contains internal repeats, alternative gene model possible
PFD0205c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0200c	hypothetical protein, conserved				Asparagine-rich protein	Obsolete product name: hypothetical protein
PFD0195c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0190w	SET domain, putative				annotation is based on Pfam match	Obsolete product name: hypothetical SET domain protein
PFD0185c	peptidase				Obsolete product name: hypothetical protein, conserved	<b>attribution</b>:
PFD0180c	CGI-201 protein, short form	RNA binding	spliceosome assembly		Obsolete product name: short form CGI-201 protein, putative	
PFD0175c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0170c	hypothetical protein, conserved				Obsolete product name: hypothetical protein	
PFD0165w	ubiquitin-specific protease, putative	ubiquitin thiolesterase activity	protein deubiquitination	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0160w	hypothetical protein, conserved				Alternative splicing could exist. 2 probable transmembrane helices predicted by TMHMM2.0 at aa 297-319 and 339-361	Obsolete product name: hypothetical protein
PFD0155c	hypothetical protein				Obsolete product name: hypothetical protein, conserved	1 probable transmembrane helix predicted by TMHMM2.0 at aa 7-24
PFD0150w	hypothetical protein				Obsolete product name: hypothetical protein, conserved	Hypothetical protein, similarity primarily to N-terminus of Drosophila melanogaster; sd07741p protein.
PFD0145c	hypothetical protein, conserved				Not sufficient evidence to annotate it as RCC1 homologue although prosite hit shows weak homology to RCC1	Obsolete product name: hypothetical protein
MAL4_tRNA_Asn1	tRNA Asparagine				tRNA Asn anticodon GTT	
PFD0144c	hypothetical protein				Obsolete product name: hypothetical protein	
PFD0135w	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR, pseudogene
PFD0135c	rifin, truncated	molecular_function	biological_process		Truncated RIFIN; it is possible that it is part of RIFIN pseudogene as there is a stop codon just after the 140 th amino acid position in exon 2 and even if it is expressed, it is unlikely to be functional	RIF truncated
PFD0134c	RIF pseudogene, RIFIN pseudogene				Possible RIF pseudogene, match starts at around position 160 after the stop codon in the preceding RIFIN pseudogene.	
PFD0125c	stevor	molecular_function	biological_process	Maurer's cleft, membrane	1 probable transmembrane helix predicted by TMHMM2.0 at aa 262-284; Signal peptide predicted by SignalP2.0 HMM (Signal peptide probabilty 0.985, signal anchor probability 0.000) with cleavage site probability 0.797 between residues 19 and 20	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)
PFD0120w	RIF pseudogene, RIFIN pseudogene				Possible RIF pseudogene, stop codon at what would be codon position 141 in exon II	RIF, pseudogene
PFD0115c	hypothetical protein				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.988) with cleavage site probability 0.000 between residues 30 and 31; 1 probable transmembrane helix predicted by TMHMM2.0 at aa 12-29	Obsolete product name: hypothetical protein
PFD0110w	normocyte-binding protein 1, pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0100c	surface-associated interspersed gene 4.1, (SURFIN4.1)				Formerly PFD0100c and PFD0105c. These have been joined to form the present model(PFD0100c); This reflects the domain organisation observed in other members of the surfin gene family (PMID:15939796)	Gene model formed by joining PFD0100c and PFD0105c.
PFD0095c	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	N-terminal similarity to RESA protein of P. falciparum. 1 probable transmembrane helix predicted by TMHMM2.0 at aa 20-39;Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.005, signal anchor probability 0.992) with cleavage site probability 0.003 between residues 31 and 32
PFD0090c	hypothetical protein, conserved in P.falciparum				Partial similarity to Borrelia burgdorferi hypothetical 54.3 KDa protein. Signal anchor predicted by SignalP2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.755) with cleavage site probability 0.0000 between residues 46 and 47; 1 probable transmembrane helix predicted by TMHMM2.0 at aa 30-47	Obsolete product name: hypothetical protein
PFD0085c	acyl-Coa synthetase, PfACS6	long-chain-fatty-acid-CoA ligase activity	fatty acid transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0080c	hypothetical protein, conserved in P.falciparum				Obsolete product name: hypothetical protein	1 probable transmembrane helix predicted by TMHMM2.0 at aa 7-29; Signal anchor predicted by SignalP2.0 HMM (Signal peptide probabilty 0.188, signal anchor probability 0.720) with cleavage site probability 0.069 between residues 32 and 33. fasta;
PFD0075w	hypothetical protein, conserved in P. falciparum			apicoplast	Obsolete product name: hypothetical protein family, conserved in P. falciparum	1 probable transmembrane helix predicted by TMHMM2.0 at aa 332-353; Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.658, signal anchor probability 0.019) with cleavage site probability 0.308 between residues 23 and 24
PFD0070c	rifin	molecular_function	biological_process	Maurer's cleft, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD0065w	stevor pseudogene	molecular_function	antigenic variation	host cell plasma membrane, membrane	stevor pseudogene	Stop codon at what would be codon position 141 of exon 2; if it is expressed, it is unlikely to be functional
PFD0060w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	1 probable transmembrane helix predicted by TMHMM2.0 at aa 287-309
PFD0055w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted by TMHMM2.0 at aa 333-355	RIF
PFD0050w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFD0045c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.652, signal anchor probability 0.067) with cleavage site probability 0.410 between residues 20 and 21; 1 probable transmembrane helix predicted by TMHMM2.0 at aa 267-289
PFD0040c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	1 probable transmembrane helix predicted by TMHMM2.0 at aa 287-309.
PFD0035c	stevor	molecular_function	biological_process	Maurer's cleft, membrane	2 probable transmembrane helices predicted by TMHMM2.0 at aa 175-197 and 250-272	Obsolete product name: stevor
PFD0030c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD0025w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Obsolete product name: rifin	RIF
PFD0020c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFD0015c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFD0005w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
PFC1125w	hypothetical protein, conserved in P. falciparum				SNAP prediction, on sequence MAL3 score -19.298	annotation change, aeb, 111104, new gene model defined.
PFC1120c	var (3D7-varT3-2)				(3D7-varT3-2)	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)
PFC1115w	rifin (3D7-rifT3-7)				Similarity to other P.falciparum rifins. Member of a multi-gene family, signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.631, signal anchor probability 0.016) with cleavage site probability 0.265 between residues 26 and 27	rifin (3D7-rifT3-7)
PFC1110w	VARC pseudogene				VARC pseudogene	
PFC1105w	stevor (3D7-stevorT3-2)		biological_process		Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)	Similarity to other P.falciparum stevors. Member of a multi-gene family, signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.909, signal anchor probability 0.014) with cleavage site probability 0.559 between residues 19 and 20
PFC1100w	rifin				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFC1095w	rifin (3D7-rifT3-5)				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Similarity to other P.falciparum rifins. Member of a multi-gene family, signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.907, signal anchor probability 0.091) with cleavage site probability 0.479 between residues 23 and 24
PFC1090w	hypothetical protein, conserved in P. falciparum			apicoplast, membrane	Contains potential signal and membrane anchor regions, similarity: P. falciparum chr. 2, PFB0995W, AAC71987, predicted integral membrane protein (257 aa) fasta scores: opt: 1625, E(): 0, 99.2% identity in 257 aa overlap	
PFC1085c	hypothetical protein, conserved			apicoplast		
PFC1080c	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 3, PfMC-2TM_3			membrane	Similar to P. falciparum chromosome 2, PFB0985C, O96287 predicted integral membrane protein (186 aa), fasta scores: opt: 919, E():0, 78.2% identity in 188 aa overlap, contains potential signal sequence and membrane anchor region	PfMC-2TM_3
PFC1075w	hypothetical protein				Some similarity to a larger P. knowlesi CDS	
PFC1070c	VARC pseudogene				pseudo gene, similar to varC	VARC pseudogene
PFC1065w	hypothetical protein, conserved				annotation change, aeb, 111104, exons 3, 4, 5 and 6 annotated. Proteomics evidence exists for intron 4.	annotation change, aeb, 121104, extended and added 5' exon, conserved in P. knowlesi and P. yoelii but splicing may be different;
PFC1060c	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii	
PFC1055w	hypothetical protein, conserved				Revised: added 3' exon by similarity with P.knowlesi and P. yoelii	
PFC1050w	hypothetical protein, conserved				Splicing confirmed in P. knowlesi and P. yoelii	
PFC1045c	hypothetical protein, conserved				Conserved in P. knowlesi and P. yoelii but spliced in P. knowlesi; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.999, signal anchor probability 0.000) with cleavage site probability 0.984 between residues 19 and 20	
PFC1040w	hypothetical protein, conserved				Conserved in P. knowlesi and P. yoelii	
PFC1035w	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii	
PFC1030w	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii	
PFC1025w	F49C12.11-like protein				Splicing confirmed in P. knowlesi and P. yoelii	
PFC1020c	40S ribosomal protein S3A, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC1016w	hypothetical protein, conserved				Revised: new gene prediction, splicing conserved in P. yoelii and P. knowlesi	
PFC1015c	hypothetical protein, conserved				Probably spliced to PFC1011c by comparison with P.knowlesi and P. yoelii	Revised: new gene prediction, probably spliced to PFC1015c by comparison to PFC1015c by comparison to P. knowlesi and P. yoelii
PFC1011c	hypothetical protein, conserved				Revised: new gene prediction, probably spliced to PFC1015c by comparison to PFC1015c by comparison to P. knowlesi and P. yoelii	Probably spliced to PFC1011c by comparison with P.knowlesi and P. yoelii
PFC1010w	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii but could be unspliced in P. yoelii	
PFC1005c	HesB-like domain protein				Pfam match to entry PF01521 HesB-like, HesB-like domain, score 55.50, E-value 1.1e-12; HesB may be involved in Nitrogen fixation	
PFC1000w	hypothetical protein, conserved				Revised: added two 3' exons, splicing confirmed in P. knowlesi and P. yoelii	
PFC0995c	diacylglycerol O-acyltransferase, putative	diacylglycerol O-acyltransferase activity	triacylglycerol biosynthetic process		Pfam match to entry PF01800 ACAT, Sterol O-acyltransferase, score 165.90, E-value 6.7e-46	<b>attribution</b>:
PFC0990c	hypothetical protein, conserved				Revised: drastically, merged PFC0985c and PFC990c by making a 14 exon structure, splicing confirmed in P. yoelii but difficult to predict first exon	
PFC0980c	mRNA capping enzyme				Pfam match to entry PF02940 mRNA_triPase, mRNA capping enzyme, beta chain, score 558.50, E-value 4.4e-164	Revised: added 5' exon, revised; removed 5'exon in comparison with p. knowlesi and P. yoelii
PFC0975c	PFCYP19, cyclophilin, peptidyl-prolyl cis-trans isomerase	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding	cytosol	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0970w	hypothetical protein, conserved				Revised: added six 3' exons, revised: splicing confirmed in P. yoelii although this has a different splicing pattern	
PFC0965w	hypothetical protein, conserved				CDS confirmed in P. knowlesi and P. yoelii	
PFC0960c	hypothetical protein, conserved				Revised: added two 3' exons, splicing confirmed in P. knowlesi and P. yoelii	
PFC0955w	ATP-dependent RNA helicase				Similarity to ATP-dependent RNA helicases eg C. elegans (TR:Q93382) BLAST Score: 282, sum P(2) = 4.9e-36; 26% identity in 293 aa overlap, Pfam: match to PF00270 DEAD, DEAD/DEAH box helicase Score 96.12, match to PF00271 helicase_C, Helicases conserved C-terminal domain Score 68.61, E-value 4.4e-29; revised: added 3' exon, splicing confirmed in P. yoelii and P. knowlesi	
PFC0950c	peptidase, putative	peptidase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0945w	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation		Pfam: match to PF00069 pkinase, Eukaryotic protein kinase domain Score 37.71,E-value 3.4e-09; revised: added 3 3' exons, revised: deleted exon 4 in comparison with P. knowlesi and P. yoelii; splicing confirmed in P. yoelii	
PFC0940c	hypothetical protein, conserved				Likely to be spliced with at least an upstream exon eg 82389..82653, there is a clear donor but not a clear acceptor for this; CDS conserved in P.knowlesi and P. yoelii	
PFC0935c	N-acetylglucosamine-1-phosphate transferase, putative	UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity	dolichol-linked oligosaccharide biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0930c	hypothetical protein, conserved				CDS conserved in P. yoelii	
PFC0925w	hypothetical protein, conserved			apicoplast	Revised: shortened and added 3' exon, splicing confirmed in P. yoelii; contains possible signal sequence	
PFC0920w	histone H2A variant, putative	DNA binding	chromatin assembly or disassembly	nucleosome	Similarity: eg to C.elegans histone H2A variant (TR:Q27511) BLAST Score: 498, sum P(1) = 7.3e-48; 79% identity in 127 aa overlap, Pfam: match to PF00125 histone, Core histone H2A/H2B/H3/H4 Score 140.44; splicing confirmed in P. knowlesi and P. yoelii	Pfam match to entry PF00125 histone, Core histone H2A/H2B/H3/H4, score 153.20, E-value 4.5e-42
PFC0915w	ATP-dependent RNA helicase, putative	ATP-dependent RNA helicase activity			Similarity to eg A.thaliana ATP-dependent RNA helicase (TR:O80838) BLAST Score: 1552, sum P(1) = 1.5e-159; 73% identity in 400 aa overlap, Pfam: match to PF00270 DEAD, DEAD/DEAH box helicase Score 150.75, E-value 4.2e-52; splicing confirmed in P. yoelii	
PFC0912w	hypothetical protein, conserved				Revised: new gene prediction, splicing conserved in P. yoelii	
PFC0911c	hypothetical protein, conserved				Revised: gene prediction, splicing conserved in P. yoelii	
PFC0910w	hypothetical protein, conserved				Pfam match to entry PF00857 Isochorismatase, Isochorismatase family, score -45.90, E-value 0.071	CDS conserved in P. knowlesi and P. yoelii
PFC0905c	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.763, signal anchor probability 0.131) with cleavage site probability 0.249 between residues 22 and 23	
PFC0900w	T-complex protein 1 epsilon subunit, putative	unfolded protein binding	protein folding	chaperonin-containing T-complex	Similarity to T-complex protein 1, epsilon subunit. H.sapiens T-complex protein 1, epsilon subunit (SW:TCPE_HUMAN) BLAST Score: 1585, sum P(1) = 4.8e-163; 55% identity in 532 aa overlap, Pfam: match to PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family Score 596.57, E-value 1.5e-167	
PFC0895w	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii but unable to confirm splicing at 5'	
PFC0890w	Sec22 subunit, putative		vesicle-mediated transport		Revised: added 2 3' exons, splicing confirmed in P. knowlesi and P. yoelii; similar eg to Mus musculus vesicle trafficking protein sec22b sec22l1 TR:O08547 (EMBL:U91538) (215 aa) fasta scores: E(): 2.1e-09, 31.27% id in 227 aa; contains PFAM synaptobrevin motif 128-214, IPR001388	match to peptide TMCDVVLLCR from proteomics study (PUBMED:12368870) suggests that CDS extends upstream relative to original proposed start codon; revised: unable to splice upstream exon
PFC0886w	hypothetical protein, conserved				Revised: new gene prediction, exons 3 and 4 but not 5 confirmed in partial P. knowlesi contig	
PFC0885c	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii	
PFC0880c	hypothetical protein, conserved				CDS conserved in P. knowlesi	
PFC0875w	ABC transporter, putative				Pfam match to entry PF00005 ABC_tran, ABC transporter, score 72.50, E-value 9e-18	GPI-Anchor Signal predicted for PFC0875w by DGPI v2.04, no cleavage site predicted
PFC0870w	elongation factor 1 (EF-1), putative	translation elongation factor activity	translational elongation	eukaryotic translation elongation factor 1 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0865w	RNA-binding protein, putative	RNA binding			Similarity eg to C.elegans RNA-binding protein (TR:Q18318) BLAST Score: 378, sum P(1) = 3.8e-35; 37% identity in 297 aa overlap; splicing conserved in P. knowlesi and P. yoelii; Pfam: match to PF00076 rrm, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Score 58.01, E-value 1.1e-20	
PFC0860w	kinesin, putative	ATPase activity, microtubule motor activity	microtubule-based movement	kinesin complex	Similarity: to kinesin-related protein. D.melanogaster kinesin-like protein 67A (TR:P91945) BLAST Score: 664, sum P(2) = 1.9e-67; 28% identity in 707 aa overlap; Pfam: match to PF00225 kinesin (6.1e-86), Kinesin motor domain Score 311.54 E-value 6.1e-86	<b>attribution</b>:
PFC0855w	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin cycle		Pfam match to entry PF00179 UQ_con, Ubiquitin-conjugating enzyme, score 246.30, E-value 4.2e-70	Similarity to ubiquitin-conjugating enzyme E2-17 kDa. A.thaliana ubiquitin-conjugating enzyme E2-17 kDa (SW:UBC2_ARATH) BLAST Score: 436, sum P(1) = 2.7e-41; 56% identity in 141 aa overlap, revised: added small 3' exon
PFC0850c	hypothetical protein, conserved			apicoplast	Revised: extended to upstream initiation codon; CDS conserved in P. yoelii	
PFC0845c	ubiquitin--protein ligase, putative	ubiquitin-protein ligase activity	ubiquitin-dependent protein catabolic process	apicoplast, ubiquitin ligase complex	Similarity to hypothetical proteins/ ring finger proteins eg C.elegans protein ZK287.5 (TR:Q23457) BLAST Score: 375, sum P(1) = 7.9e-35; 66% identity in 105 aa overlap, revised: removed first exon and shortened second; CDS conserved in P. knowlesi and P. yoelii	<b>attribution</b>:
PFC0840w	P-type ATPase, putative	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism, transporter activity	cation transport	integral to plasma membrane	PfATPase7	<b>attribution</b>:
PFC0835c	hypothetical protein, conserved				Revised: added two 5' exons, the first is tentative, CDS conserved in P. yoelii but cannot confirm splicing at 5'; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.700, signal anchor probability 0.261) with cleavage site probability 0.649 between residues 22 and 23	
PFC0831w	triosephophate isomerase, putative	triose-phosphate isomerase activity	glycolysis	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0830w	trophozoite stage antigen				Almost identical to trophozoite stage antigen SWALL:Q9U627 (EMBL:AF198251); revised: split original PFC0830w into two separate genes	
PFC0825c	cleavage and polyadenylation specificity factor protein, putative	mRNA binding	mRNA cleavage, mRNA polyadenylation	mRNA cleavage and polyadenylation specificity factor complex	SNAP prediction, on sequence MAL3 score 155.784	<b>attribution</b>:
PFC0820w	hypothetical protein, conserved				annotation change, aeb, 121105, gene model modified on the basis of comparison of regions of conserved synteny with P. knowlesi and P. vivax. Eleven amino acids removed from the predicted protein sequence in the N- terminal region	CDS conserved in P. knowlesi and P. yoelii
PFC0815c	hypothetical protein, conserved				Revised: split original orf into 2 exons and added 15 3' exons, splicing conserved in P. yoelii	
PFC0810c	hypothetical protein, conserved			apicoplast	Splicing conserved in P. knowlesi	
PFC0805w	DNA-directed RNA polymerase II, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0800w	band 7-related protein				Similarity to S.pombe hypothetical protein SPBC16G5.07C (TR:O60121) BLAST Score: 700, sum P(1) = 2.9e-69; 46% identity in 297 aa overlap, Pfam: match to PF01145 band_7, SPFH domain / band 7 family Score 200.06, E-value 1.3e-51	
PFC0795w	hypothetical protein, conserved			apicoplast	CDS conserved in P. knowlesi and P. yoelii; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.919, signal anchor probability 0.002) with cleavage site probability 0.576 between residues 19 and 20	
PFC0790w	hypothetical protein, conserved				Revised: added 5' exon, revise: delete first exon in comparison with P. yoelii	
PFC0785c	proteasome regulatory protein, putative		ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0780w	hypothetical protein, conserved				Revised: added nine 3' exons, splicing confirmed in P. yoelii	
PFC0775w	40S ribosomal protein S11, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0770c	kinesin-related protein, putative	microtubule motor activity		kinesin complex	Splicing confirmed at 5' in P. knowlesi; similarity to kinesins. H.sapiens kinesin-related protein (SW:EG5_HUMAN) BLAST Score: 745, sum P(3) = 2.8e-90; 33% identity in 649 aa overlap, predicted using hexExon Pfam: match to PF00225 kinesin, Kinesin motor domain Score 375.97, E-value 1.1e-115	<b>attribution</b>:
PFC0765c	hypothetical protein, conserved				Revised: added 3' exon, splicing confirmed in P. yoelii and P. knowlesi but different in latter	
PFC0760c	hypothetical protein, conserved					
PFC0755c	protein kinase, predicted	protein serine/threonine kinase activity	protein amino acid phosphorylation		CMGC group (PMID:15479470)	<b>attribution</b>:
PFC0750w	hypothetical protein, conserved				Revised: added internal exon 2, revised: deleted exon 2 in comparison with P. yoelii; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.981, signal anchor probability 0.000) with cleavage site probability 0.865 between residues 21 and 22	GPI-Anchor Signal predicted for PFC0750w by DGPI v2.04 with cleavage site probability 0.152 near 929
PFC0745c	proteasome component C8, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0740c	binding protein, putative	zinc ion binding			Revised: added 5' exon, splicing confirmed in P. yoelii; Pfam: match to PF00097 zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Score 37.17, E-value 1.5e-06	
PFC0735w	40S ribosomal protein S15A, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Similarity to 40S ribosomal protein S15A. H.sapiens 40S ribosomal protein S15A (SW:RS1A_HUMAN) BLAST Score: 505, sum P(1) = 1.3e-48; 72% identity in 129 aa overlap, predicted using hexExon, Pfam: matches to PF00410 Ribosomal_S8, Ribosomal protein S8, score 175.90, E-value 6e-53	<b>attribution</b>:
PFC0730w	conserved protein, putative	molecular_function	biological_process		Similarity: eg to DP1_HUMAN polyposis locus protein 1 (TB2 protein). (185 aa) fasta scores: opt: 423, E(): 5.6e-21, 42.0% identity in 150 aa overlap	<b>attribution</b>:
PFC0725c	formate-nitrate transporter, putative	transporter activity	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0720w	hypothetical protein, conserved				Revised: extended ORF to upstream initiation codon; CDS conserved in P. knowlesi	
PFC0715c	hypothetical protein, conserved			apicoplast	CDS confirmed in P. yoelii; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.815, signal anchor probability 0.000) with cleavage site probability 0.281 between residues 20 and 21	
PFC0710w	inorganic pyrophosphatase, putative	pyrophosphatase activity	metabolic process		Similarity to inorganic pyrophosphatases eg C.elegans (TR:Q18680) BLAST Score: 431, sum P(1) = 9.2e-41; 43% identity in 201 aa overlap; splicing confirmed in P. yoelii; Pfam: match to PF00719 Pyrophosphatase, Inorganic pyrophosphatase Score 91.89, E-value 1.8e-40	
PFC0705c	hypothetical protein, conserved				Revised: changed splice donor sequence for exon 1; splicing confirmed in P. yoelii	
PFC0701w	hypothetical protein, conserved				Revised: new gene prediction; CDS conserved in P. knowlesi and P. yoelii	
PFC0700c	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yeolii	
PFC0695w	hypothetical protein, conserved				Revised: deleted first exon, chose alternative acceptor sequence, revised: changed donor exon 1; signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.887, signal anchor probability 0.000) with cleavage site probability 0.196 between residues 23 and 24	
PFC0690c	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii; Pfam: match to entry PF00096 zf-C2H2, Zinc finger, C2H2 type, score 21.00, E-value 0.028	
PFC0685w	hypothetical protein, conserved				Revised: added 3' exon, splicing confirmed in P. knowlesi and P. yoelii	
PFC0680w	hypothetical protein, conserved				Revised: added internal exon 2, splicing confirmed in P. yoelii	
PFC0675c	hypothetical protein, conserved				Revised: deleted first exon, CDS confirmed in P. knowlesi and P. yoelii	
PFC0670c	hypothetical protein, conserved			apicoplast	CDS conserved in P. knowlesi and P. yoelii; signal anchor predicted for PFC0670c, MAL3P5.18 by SignalP 2.0 HMM (Signal peptide probabilty 0.152, signal anchor probability 0.752) with cleavage site probability 0.054 between residues 23 and 24	
PFC0650w	hypothetical protein, conserved				Splicing conserved in P. knowlesi and P. yoelii	
PFC0645w	hypothetical protein, conserved				Revised: modified by adding exons 3, 4 and 5 and changing the original 3' exon to three separate exon, splicing conserved in P. yoelii	
PFC0640w	CSP and TRAP-related protein (CTRP)		cell-cell adhesion		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0635c	translation initiation factor E4, putative	translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 4F complex	Similarity to initiation factor E4, predicted using hexExon, Pfam: match to entry PF01652 IF4E, Eukaryotic initiation factor 4E, score -34.70, E-value 1.6e-06	
PFC0630w	hypothetical protein, conserved				Splicing confirmed in P. knowlesi and P. yoelii	
PFC0625w	hypothetical protein, conserved				CDS confirmed in P. knowlesi	
PFC0615w	hypothetical protein, conserved				Revised: new genemodel merged PFC0615w (MAL3P5.9) and PFC0620w (MAL3P5.10); PFC0620w (MAL3P5.10) obsoleted	
PFC0610c	hypothetical protein				Pfam: match to entry PF00097 zf-C3HC4, Zinc finger, C3HC4 type (RING finger), score 32.80, E-value 8.5e-09	
PFC0605w	hypothetical protein, conserved				CDS conserved in P.knowlesi and P. yoelii	
PFC0600w	hypothetical protein, conserved				Revised: changed exon 1 and exon 2 acceptor, revised: changed ATG and donor in comparison with P. yoelii	
PFC0595c	serine/threonine protein phosphatase, putative	protein serine/threonine phosphatase activity	protein amino acid dephosphorylation		Predicted using hexExon, Pfam: match to entry PF00149 STphosphatase, Ser/Thr protein phosphatase, score 579.40, E-value 2.3e-170	<b>attribution</b>:
PFC0590c	der1-like protein, putative			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.921, signal anchor probability 0.075) with cleavage site probability 0.888 between residues 20 and 2, revised: changed donor in comparison with P. knowlesi	
PFC0582c	hypothetical protein, conserved				Revised: new gene prediction	
PFC0581w	hypothetical protein, conserved				Revised: new gene prediction, splicing prediction very tentative	
PFC0580c	hypothetical protein, conserved			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.635, signal anchor probability 0.287) with cleavage site probability 0.594 between residues 21 and 22; CDS conserved in p. knowlesi and P.yoelii	
PFC0575w	hypothetical protein, conserved			apicoplast	Possible signal sequence present, revised: added new exon 2, revised: incorporated new intron in last exon in comparison with P. knowlesi and P. yoelii	
PFC0571c	hypothetical protein, conserved				Revised: new gene prediction, revised: removed exon 1, lengthened present exon 4, shortened last exon by comparison with P.yoelii and P.knowelsi	
PFC0570c	hypothetical protein, conserved				Revised: deleted first exon and added 4 more at 5'; splicing confirmed in P. knowlesi and P. yoelii	
PFC0565w	hypothetical protein, conserved				CDS conserved in P. knowlesi and P. yoelii	
PFC0560c	hypothetical protein, conserved					
PFC0556c	hypothetical protein, conserved				Revised: new gene prediction, conserved in P. knowlesi and P. yoelii; could be spliced upstream	
PFC0555c	hypothetical protein, conserved			apicoplast	CDS conserved in P. knowlesi and P. yoelii	
PFC0550w	hypothetical protein, conserved					
PFC0545c	hypothetical protein, conserved				Revised: added 3' exon	
PFC0540w	hypothetical protein				Revised: added two 5' exons and one 3' exon	
PFC0535w	60S ribosomal protein L26, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL3_tRNA_Ile1	tRNA Isoleucine				anticodon AAT,cove score 84.11	
MAL3_tRNA_Val1	tRNA Valine				anticodon GTT,cove score 80.68	
PFC0530w	transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0525c	glycogen synthase kinase 3	glycogen synthase kinase 3 activity	peptidyl-serine phosphorylation		Similarity to glycogen synthase kinases. D.discoideum glycogen synthase kinase (SW:KG3H_DICDI) BLAST Score: 1001, sum P(1) = 3.7e-101; 51% identity in 393 aa overlap; revised: changed first exon, splicing confirmed in P. yoelii	<b>attribution</b>:
PFC0520w	26S proteasome regulatory subunit S14, putative		ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	Similarity to 26S Proteasome regulatory subunit S14. H.sapiens 26S proteasome regulatory subunit S14 (SW:PSD8_HUMAN) BLAST Score: 349, sum P(1) = 4.5e-32; 35% identity in 253 aa overlap	<b>attribution</b>:
PFC0515c	hypothetical protein, conserved				Pfam match to entry PF00515 TPR, TPR Domain, score 29.80, E-value 6.2e-05	
PFC0510w	zinc finger protein, putative				Contains match to PF00097 zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Score 30.90, similarity: part to A. thaliana AAD21704 AT2G20650 (276 aa) fasta scores: opt: 629, E(): 6.9e-29, 38.4% identity in 276 aa overlap	
PFC0506w	hypothetical protein, conserved				Revised: new gene prediction, REVISED: deleted 3' exon in comparison with P. yoelii and P. knowlesi	
PFC0505c	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0500w	hypothetical protein, conserved				Revised: extended and added 5' exon; splicing confirmed in P. yoelii and P. knowlesi	
PFC0495w	aspartyl protease, putative	aspartic-type endopeptidase activity	proteolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0490w	dolichyl-diphospho-oligosaccharide protein				Revised: added two 3' exons, some similarity to oligosaccharyl transferase essential subunit; splicing conserved in P.yoelii and P. knowlesi	
PFC0486c	hypothetical protein, conserved					
PFC0485w	protein kinase,putative	protein serine/threonine kinase activity	protein amino acid phosphorylation		Similarity to serine/threonine protein kinases. P.falciparum protein kinase (TR:Q27731) BLAST Score: 282, sum P(3) = 3.3e-20; 34% identity in 292 aa overlap, revised acceptor for exon 2	<b>attribution</b>:
PFC0475c	hypothetical protein, conserved				Revised: new prediction made by joining PFC0475c and PFC0480c with two new exons in between; splicing confirmed in P. yoelii	
PFC0470w	valine -- tRNA ligase, putative	valine-tRNA ligase activity	valyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0465c	hypothetical protein, conserved				Revised: changed exon 2 acceptor, added exon 4, splicing confirmed although different pattern of splicing in P. yoelii and P. knowlesi; Match to PF01480 PWI, PWI domain Score 148.85	
PFC0460w	hypothetical protein, conserved				Revised: shortened at 5' in comparison with P. yoelii	
PFC0455w	synbindin-like protein, putative					
PFC0450w	hypothetical protein, conserved			apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.022, signal anchor probability 0.976) with cleavage site probability 0.007 between residues 19 and 20; CDS conserved in P. knowlesi	
PFC0445w	hypothetical protein, conserved				Revised: extended upstream and added exon, GC plots suggest more, similarity: eg to human cDNA AAF29135 HSPC172 (219 aa), fasta scores, opt: 257, E(): 6.9e-11 (40.0% identity in 115 aa overlap); splicing confirmed in P. yoelii and P.knowlesi	
PFC0441c	eukaryotic translation initiation factor, putative				Revised: new gene prediction; splicing confirmed in P. yoelii	
PFC0440c	helicase, putative	helicase activity			Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain, score 48.20, E-value 1.8e-10	Similarity to helicases. C.elegans helicase (WP:F52B5.3) BLAST Score: 290, sum P(4) = 5.9e-31; 34% in 199 aa overlap
PFC0435w	hypothetical protein, conserved			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.995, signal anchor probability 0.005) with cleavage site probability 0.397 between residues 17 and 18	
PFC0430w	hypothetical protein, conserved				Revised: removed 5' exon	
PFC0425w	hypothetical protein, conserved					
PFC0420w	calcium-dependent protein kinase 3	calcium- and calmodulin-dependent protein kinase activity	protein amino acid phosphorylation		PfCDPK3	Similarity to calcium-dependent protein kinases. P.falciparum calcium-dependent protein kinase CDPK2 (TR:O15865) BLAST Score: 1069, sum P(1) = 2.3e-108; 43% identity in 517 aa overlap; revised: shortened exon 4 and added exon 5, revised: shortened exon 3; splicing confirmed in P. yoelii
PFC0416w	hypothetical protein, conserved			apicoplast	GC-plots indicate a gene in this region of which this prediction may be an approximation, the predicted splicing is uncertain, revised: new gene prediction	
PFC0415c	hypothetical protein, conserved				Revised: extended at 5'end and added two 5' exons	
PFC0410w	rat BRAIN protein-like				Putative homologue of Rat BRAIN protein; some similarity to the C-terminus of R.norvegicus BRAIN protein YT521. R.norvegicus BRAIN protein YT51 (TR:O54729) BLAST Score: 263, sum P(1) = 6.2e-22; 40% in 155 aa overlap; splicing confirmed in P. yoelii	
PFC0405c	hypothetical protein, conserved					
PFC0400w	60S Acidic ribosomal protein P2		translational elongation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), large ribosomal subunit	Similarity to 60S acidic ribosomal proteins. B. bovis 60S acidic ribosomal protein P2 (SW:RLA2_BABBO) BLAST Score: 286, sum P(1) = 2.1e-25; 54% identity in 111 aa overlap	Pfam match to entry PF00428 60s_ribosomal, 60s Acidic ribosomal protein, score 106.90, E-value 1.2e-32
PFC0395w	asparagine synthetase, putative	asparagine synthase (glutamine-hydrolyzing) activity	asparagine biosynthetic process		Pfam match to entry PF00733 Asn_synthase, Asparagine synthase, score 728.10, E-value 4e-215	<b>attribution</b>:
PFC0390w	hypothetical protein, conserved					
PFC0385c	serine/threonine protein kinase, putative	protein serine/threonine kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0381c	hypothetical protein, conserved				Revised: new gene prediction or could be part of upstream PFC0385c, revised: removed 5' exon, changed donor of second exon; splicing confirmed in P. yoelii and P.knowlesi; signal anchor predicted for PFC0381c by SignalP 2.0 HMM (Signal peptide probabilty 0.297, signal anchor probability 0.676) with cleavage site probability 0.101 between residues 24 and 25	
PFC0380w	dual-specificity protein phosphatase, putative	protein tyrosine/serine/threonine phosphatase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0375c	splicing factor, putative					
PFC0371w	hypothetical protein, conserved				Renamed from PFC0370w; splicing confirmed in P. yoelii and P. knowlesi	
PFC0370w	hypothetical protein, conserved				Revised: added 3' exon; splicing confirmed in P. yoelii and P. knowlesi	
PFC0365w	conserved protein, putative			nuclear matrix	Possible matrix protein; similar to Mus musculus putative nuclear matrix protein SneV sneV TR:AAK49039 (EMBL:AF251503) (504 aa) fasta scores: E(): 6.6e-23, 33.27% id in 556 aa, contains 7x PFAM matches to PF00400 WD40, WD domain, G-beta repeat	
PFC0360w	hypothetical protein, conserved				Similar to C-terminal half of a number of hypothetical proteins eg AAF29000, human HSPC322 (fragment) (272 aa), fasta scores: opt: 243, E(): 3.6e-11, 30.3% identity in 132 aa overlap, revised: added 3' exon; splicing confirmed in P. yoelii and P. knowlesi	
PFC0358w					Similar to HSUGU4CA M15957 Human U4C small nuclear RNA gene	Gene name changed from  PFC0358c to PFC0358w. No change in sequence or model
PFC0355c	hypothetical protein					
PFC0350c	T-complex protein eta subunit, putative	unfolded protein binding	protein folding	chaperonin-containing T-complex	Similarity to H.sapiens T-complex protein, eta subunit (SW:TCPH_HUMAN) BLAST Score: 1549, sum P(1) = 3.1e-159; 57% identity in 526 aa overlap; splicing confirmed in P. yeolii and P. knowlesi.	Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family, score 509.20, E-value 3e-149
PFC0345w	hypothetical protein					
PFC0340w	DNA polymerase delta small subunit, putative	delta DNA polymerase activity		delta DNA polymerase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0335c	hypothetical protein, conserved				Splicing confirmed in P. yoelii	
PFC0330w	hypothetical protein, conserved			apicoplast	Weak match (E-value 0.29) to PF00595 PDZ, PDZ domain (Also known as DHR or GLGF); signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.293, signal anchor probability 0.631) with cleavage site probability 0.142 between residues 23 and 24	<b>attribution</b>:
PFC0325c	hypothetical protein, conserved				cDNA EST EMBL:T18200 comes from this gene, revised: added two 5' and two 3' exons; splicing conserved in P. yoelii	
PFC0320w	hypothetical protein, conserved				Revised: added two 5'exons; exons conserved in p. yoelii	
PFC0315c	hypothetical protein, conserved				Revised: added three 3' exons; splicing confirmed in P. knowlesi and P. yoelii	
PFC0310c	ATP-dependent CLP protease, putative	endopeptidase Clp activity	protein catabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0305w	EB1 homolog, putative				Similarity to Human EB1 protein. H.sapiens EB1 protein (TR:Q156910) BLAST Score: 325, sum P(2) = 6.2e-35; 46% identity in 122 aa overlap	
PFC0300c	60S ribosomal protein L7, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0295c	40S ribosomal protein S12, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Pfam match to entry PF01248 Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family, score 111.60, E-value 1.5e-29	Similarity to 40S ribosomal protein S12. X.laevis 40S ribosomal protein S12 (SW:RS12_XENLA) BLAST Score: 286, sum P(1) = 2.1e-25; Pfam match to entry PF01164 Ribosomal_S12e, Ribosomal protein S12e, 47% identity in 115 aa overlap
PFC0290w	40S ribosomal protein S23, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Pfam match to entry PF00164 Ribosomal_S12, Ribosomal protein S12, score 270.30, E-value 2.6e-77	Similarity to ribosomal S23 proteins. C.elegans 40S ribosomal protein S23 (WP:F28D1.7) BLAST Score:609, sum P(1) = 1.3e-59; 78% identity in 142 aa overlap
PFC0285c	T-complex protein beta subunit, putative	unfolded protein binding	protein folding	chaperonin-containing T-complex	Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family, score 518.70, E-value 4.2e-152	Similarity to T-complex proteins beta subunits. C.elegans T-complex protein beta subunit (SW:TCPB_CAEEL) BLAST Score: 1527, sum P(1) = 6.7e-157, 57% identity in 527 aa overlap, Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family, revised: added splicing at 3' end, removed 5' exon, revised: changed to being unspliced in coding region, probably spliced 5' UTR
PFC0282w	hypothetical protein, conserved				Revised: new gene prediction; CDS confirmed in P. knowlesi and P. yoelii	
PFC0281w	hypothetical protein, conserved				Revised: new gene prediction; CDS confirmed in P. knowlesi and P. yoelii	
PFC0280c	hypothetical protein, conserved				conserved in P. knowlesi and P. yoelii	
PFC0275w	FAD-dependent glycerol-3-phosphate dehydrogenase, putative	glycerol-3-phosphate dehydrogenase activity	glycerophosphate shuttle	mitochondrion	Pfam match to entry PF01266 DAO, FAD dependent oxidoreductase, score 242.30, E-value 6.9e-69	Similarity to glycerol-3-phosphate dehydrogenases. C.elegans glycerol-3-phosphate dehydrogenase (TR:P90795) BLAST Score: 846, sum P(2) = 1.6e-109; 46% identity in 364 aa overlap
PFC0271c	glutaredoxin, putative	glutathione disulfide oxidoreductase activity	response to oxidative stress		Pfam match to entry PF00462 glutaredoxin, Glutaredoxin, score 50.40, E-value 3.9e-11	Similar to eg GLRX_RABIT glutaredoxin (106 aa), fasta scores: opt: 269, E(): 2.1e-12, 38.6% identity in 101 aa overlap, revised: new gene prediction; identified as grx1, glutaredoxin 1 in AAK91589, gene model confirmed in p_knowlesi and P. yoelii
PFC0270w	hypothetical protein, conserved				Splicing confirmed in P. yoelii	
PFC0265c	hypothetical protein, conserved				Revised: added 3' exon	
PFC0262c	hypothetical protein, conserved				Revised: removed splicing	
PFC0261c	hypothetical protein, conserved				Revised: new gene prediction	
PFC0260w	hypothetical protein, conserved			apicoplast	Revised: removed 5' exon	
PFC0255c	ubiquitin-conjugating enzyme E2, putative	ubiquitin conjugating enzyme activity	ubiquitin-dependent protein catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0250c	AP endonuclease (DNA-(apurinic or apyrimidinic site) lyase), putative	DNA-(apurinic or apyrimidinic site) lyase activity	DNA repair	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0245c	hypothetical protein, conserved					
PFC0241w	hypothetical protein, conserved				Revised: shortened first exon at 5' but extended at 3' and deleted exon 2 by similarity with P.yoelii and P. knowlesi, unsure but deleted last exon	
PFC0240c	hypothetical protein, conserved				Revised: added two exons at 3' but could be more, included extra met at 5'	
PFC0235w	hypothetical protein, conserved				Revised: deleted splicing at 5' end and start at downstream inframe initiation codon	
PFC0230c	hypothetical protein, conserved				Possibilities exist for splicing at 3' end	
PFC0225c	elongation factor (EF-TS), putative	translation elongation factor activity	translational elongation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0221c	hypothetical protein, conserved					
PFC0220w	hypothetical protein, conserved				Revised by removing upstream splicing and included upstream inframe initiation codon; similar to Plasmodium vivax pv1h14160_p pv1h14160W TR:AAF99478 (EMBL:AY003872) (1092 aa) fasta scores: E(): 7e-08, 24.52% id in 1476 aa	
PFC0215c	hypothetical protein			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.788, signal anchor probability 0.191) with cleavage site probability 0.642 between residues 21 and 22	
PFC0210c	circumsporozoite (CS) protein				GPI-Anchor Signal predicted for PFC0210c by DGPI v2.04 with cleavage site probability 0.232 near 374	Similarity to many Plasmodium CS proteins, signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.996, signal anchor probability 0.000) with cleavage site probability 0.495 between residues 20 and 21, revised to include upstream initiation codon; Pfam match to entry PF00090 tsp_1, Thrombospondin type 1 domain
PFC0205c	PfGLP-1, 1-cys-glutaredoxin-like protein-1	disulfide oxidoreductase activity, glutathione disulfide oxidoreductase activity			Similarity to a number of conserved hypothetical proteins, eg N. meningitidis AAF41186 (103 aa), fasta scores opt: 345, E(): 1.1e-15, 49.0% identity in 96 aa overlap, identified as 1-cys-glutaredoxin-like protein-1 glp-1 TR:AAK00581 (EMBL:AY014839); similar to Plasmodium vivax pv1h14145_p pv1h14145C TR:AAF99475 (EMBL:AY003872) (168 aa) fasta scores: E(): 5.1e-40, 67.25% id in 171 aa	<b>attribution</b>:
PFC0200w	60S Ribosomal protein L44, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	60S Ribosomal protein L44, putative	Similar to Plasmodium vivax pv1h14140_p pv1h14140W TR:AAF99474 (EMBL:AY003872) (103 aa) fasta scores: E(): 1.8e-37, 97.11% id in 104 aa
PFC0195w	hypothetical protein, conserved				The original predicted intron was suspiciously small, it could signify a possible frameshift or different splice site(s) - the potential acceptor has been changed to one further downstream	
PFC0191c	hypothetical protein				hypothetical protein, len: 88 aa, GC peaks indicate possible coding in this region but difficult to come up with a compelling prediction, unable to find homologue in other plasmodium spp.	
PFC0190c	EH (Eps15 homology) protein	protein binding			Similarity to PAST proteins from H.sapiens and D.melanogaster. H.sapiens HPAST protein (TR:O14611) BLAST Score: 1245, sum P(1) = 5.1e-127, 47% identity in 518 aa overlap, predicted using hexExon, revised: to most upstream initiation codon but similarity with P. vivax and P. yoelii suggests met9 as initiation codon; similar to P. vivax PV1H14130C, 90.840% identity (90.840% ungapped) in 524 aa overlap	
PFC0185w	hypothetical protein, conserved					
PFC0180c	membrane skeletal protein, putative				Revised prediction: added a 4th intron by similarity with py and pk, similar to P. vivax PV1H14120C, 48.959% identity (54.982% ungapped) in 913 aa overlap	
PFC0176c	hypothetical protein, conserved				Revised gene prediction: deleted last exon by comparison with P. knowlesi, P. vivax, P. yoelii; Signal peptide predicted for PFC0176c by SignalP 2.0 HMM (Signal peptide probabilty 0.843, signal anchor probability 0.094) with cleavage site probability 0.776 between residues 22 and 23	
PFC0175w	IBR domain protein, putative				Similarity with a number of unknown proteins from model organisms. eg C.elegans hypothetical protein (TR:O01963) BLAST Score: 361, sum P(1) = 4.0e-47, 35% identity in 227 aa overlap; similarity to P. vivax PV1H14110W, 42.516% identity (45.331% ungapped) in 628 aa overlap	
PFC0170c	dihydrolipoamide acyltransferase, putative				Similarity to lipoamide acyltransferases. eg C.elegans lipoamide acyltransferase (WP:ZK669.4) BLAST Score: 582, sum P(1) = 9.2e-57; 33% identity in 430 aa overlap; similarity to P. vivax PV1H14105C, 59.908% identity (61.611% ungapped) in 434 aa overlap	<b>attribution</b>:
PFC0166w	thioredoxin-like redox-active protein, putative	thiol-disulfide exchange intermediate activity	protein thiol-disulfide exchange		freD	Revised: split original spliced gene PFC0165w into PFC0165w and PFC0166w, fasta; ; Plasmodium falciparum; thioredoxin-like redox-active protein; freD; length 179 aa; id=100%; ungapped id=100%; E()=2.1e-69; ; 179 aa overlap; query 1-179 aa; subject 1-179 aa; fasta; TR:AAF99466 (EMBL:AY003872); Plasmodium vivax; pv1h14100_p; pv1h14100W; length 179 aa; id=65.92%; ungapped id=67.42%; E()=1.5e-46; ; 179 aa overlap; query 1-177 aa; subject 1-177 aa
PFC0165w	hypothetical protein, conserved				Revised: original entry split into PFC0165w and PFC0166w	
PFC0160w	binding protein, putative	protein binding			4 weak Pfam matches to entry PF00023 ank, Ank repeat; Pfam match to entry PF01529 zf-DHHC, DHHC zinc finger domain, score 66.70, E-value 4.8e-16	Revised: revised to 8 exon structure, revised: donor for exon 7
PFC0155c	DNA-directed RNA polymerase subunit I, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	Pfam match to entry PF01192 RNA_pol_K, RNA polymerases K / 14 to 18 kDa subunit, score 75.10, E-value 1.5e-18	<b>attribution</b>:
PFC0150w	hypothetical protein, conserved				Revised prediction with different 5' exon and additional 3' exon, REVISED 3' exon for a different one by comparison with P. yoelii, P. knowlesi and P. vivax	
PFC0145c	hypothetical protein, conserved					
PFC0140c	N-ethylmaleimide-sensitive fusion protein, putative	ATPase activity	ER to Golgi vesicle-mediated transport		Similarity to a number of eukaryotic N-ethylmaleimide sensitive fusion proteins (NSFs). Human NSF (SW:NSF_MOUSE). BLAST score: 1577, sum P(2) = 2.4e-142, similar to P. vivax PV1H14070C, 80.435% identity (80.745% ungapped) in 782 aa overlap	Pfam match to entry PF00004 AAA, ATPase family associated with various cellular activities (AAA), score 265.50, E-value 7e-76
PFC0135c	nuclear export receptor, crm1 homolog	molecular_function	biological_process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0130c	hypothetical protein, conserved				Possibly spliced at 3'	
PFC0126c	hypothetical protein, conserved				Contains region similar to C. elegans BAA92262 klp17, kinesin like protein (605 aa) fasta scores: opt: 160, E(): 0.002, 42.2% identity in 64 aa overlap	
PFC0125w	ABC transporter, (TAP family)	ATPase activity, coupled to transmembrane movement of substances, multidrug transporter activity	multidrug transport	apicoplast, integral to membrane	Three regions of moderate similarity to ABC transporters, especially those from compositionally biased genomes such as Dictyostelium and P.falciparum HB3 multidrug resistance gene pfmdr2 (TR:Q08667). BLAST score: 60 Sum P(3) = 1.6e-43; Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.702, signal anchor probability 0.124) with cleavage site probability 0.426 between residues 20 and 21, similar to P. vivax PV1H14050W, 56.529% identity in 1279 aa overlap	<b>attribution</b>:
PFC0120w	Cytoadherence linked asexual protein, 3.2	cell adhesion molecule binding	cytoadherence to microvasculature, mediated by parasite protein	host cell plasma membrane	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.633, signal anchor probability 0.158) with cleavage site probability 0.331 between residues 24 and 25	<b>attribution</b>:
PFC0115c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				Pseudo-VAR gene:heavily frame-shifted genomic region with patchy similarity to PfEMP1	VAR pseudogene
PFC0110w	Cytoadherence linked asexual protein 3.1	cell adhesion molecule binding	cytoadherence to microvasculature, mediated by parasite protein	host cell plasma membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0105w	serine/threonine protein kinase, putative	protein serine/threonine kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0100c	regulatory protein, putative	molecular_function	biological_process		several Pfam matches to entry PF00400 WD40, WD domain, G-beta repeat, lowest score 32.40, E-value 1e-05	Revised prediction: added 3' exon, similar to P. vivax PV1H14040C, 77.946% identity in 594 aa overlap
PFC0095c	hypothetical protein, conserved				Splicing possible at 3' end	
PFC0090w	hypothetical protein, conserved				Possibly spliced at 3' end	
PFC0085c	hypothetical protein, conserved				Revised: new 5' donor, longer at 5' than in P. vivax TR:Q962M9 (EMBL:AY003872) so could start at second Met	
PFC0080c	hypothetical protein			apicoplast	5' exon may not be real and could start at e.g. Met in 2nd exon	
PFC0075c	hypothetical protein, conserved			apicoplast		
PFC0070c	hypothetical protein				Hypothetical protein, len: 244 aa; contains possible signal sequence but not predicted by SignalP 2.0 HMM, probably spliced at 3' - added 3' exon but alternatives exist	
PFC0065c	alpha/beta hydrolase protein, putative	hydrolase activity		apicoplast	Pfam match to entry PF00561 abhydrolase, alpha/beta hydrolase fold, score 33.90, E-value 3.8e-06	Similarity to alpha/beta hydrolases and esterases. Synechocystis sp. (SW:PRXC_SYNY3) peroxidase BLAST Score: 145, sum P(1) = 1.0e-07; contains possible signal sequence, predicted using hexExon, Signal anchor predicted by SignalP 2.0 (Signal peptide probabilty 0.004, signal anchor probability 0.995) with cleavage site probability 0.002 between residues 31 and 32
PFC0060c	Serine/threonine protein kinase, putative	protein serine/threonine kinase activity	phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0055w	hypothetical protein			apicoplast	Contains predicted signal and transmembrane region; signal sequence not predicted by SignalP 2.0, potential for splicing at 3'	
PFC0050c	acetyl-CoA synethetase, PfACS2	AMP binding, long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFC0045w	rifin-like protein			apicoplast	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF-like
PFC0040w	rifin				RIF	Similarity to other P.falciparum rifins. Member of a multi-gene family; predicted signal sequence but not predicted using SignalP 2.0 HMM
PFC0035w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFC0030c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFC0025c	stevor	molecular_function	biological_process	Maurer's cleft, membrane	stevor	Similarity to other P.falciparum stevors. Member of a multi-gene family; possible signal peptide, but not predicted using SignalP 2.0 HMM
PFC0015c	VAR C, pseudogene				VARC pseudogene	pseudo-VAR gene
PFC0010c	rifin				Pfam match to entry PF02009 Rifin_STEVOR, Rifinstevor family, score 598.60, E-value 3.8e-176	Similarity to other P.falciparum rifins. Member of a multi-gene family;
PFC0005w	PfEMP1				VAR	Pfam match to entry PF03011 PFEMP, E-value 6e-68
PFC0002c	hypothetical protein, conserved in P. falciparum				annotation change, aeb, 111120004; new gene model defined after TBLASTX comparison with P. knowlesi	
PFI1830c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1825w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted for PFI1825w by TMHMM2.0 at aa 325-347	RIF
PFI1820w	erythrocyte membrane protein 1 (PfEMP1)				Similar to Plasmodium falciparum var-like protein, Mal1p4.03 mal1p4.03 TR:Q9NFB4 (EMBL:AL031747) (1327 aa) fasta scores: E(): 0, 80.974% id in 1335 aa	<b>attribution</b>:
PFI1815c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Similar to Plasmodium falciparum RifiN, mal1p4.04 rifiN TR:Q9NFB3 (EMBL:AL031747) (372 aa) fasta scores: E(): 1.8e-85, 71.091% id in 339 aa. Pfam match to PF02009, Rifin/stevor family
PFI1810w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Signal peptide predicted for PFI1810w by SignalP 2.0 HMM (Signal peptide probabilty 0.926, signal anchor probability 0.008) with cleavage site probability 0.538 between residues 25 and 26
PFI1805w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Similar to Plasmodium falciparum variant surface antigen rifin 3 rif3 TR:Q9U737 (EMBL:AF161311) (350 aa) fasta scores: E(): 3.6e-58, 54.648% id in 355 aa. With 2 transmembrane domains. Pfam match to PF02009, Rifin/stevor family
PFI1800w	hydrolase, putative				Very weakly similar to Arabidopsis thaliana lysophospholipase-like protein t22p22_40 TR:Q9LYG5 (EMBL:AL163814) (390 aa) fasta scores: E(): 0.039, 22.965% id in 344 aa; weak similarity to several lysophospholipase/ phospholipases. ProfileScan hit to PS50187, Esterase/lipase/thioesterase active site serine.	
PFI1795c	hypothetical protein			apicoplast	3 probable transmembrane helices predicted for PFI1795c by TMHMM2.0 at aa 10-27, 191-213 and 228-250	Signal anchor predicted for PFI1795c by SignalP 2.0 HMM (Signal peptide probabilty 0.082, signal anchor probability 0.914) with cleavage site probability 0.031 between residues 27 and 28
PFI1790w	hypothetical protein, conserved in P.falciparum				No pfam hit; ScanProsite hit to PS00017; Interpro hit ATP/GTP-binding site motif A (P-loop)	
PFI1785w	hypothetical protein, conserved in P.falciparum				FPrintScan hit to PR01497, Shal voltage-gated K+ channel family signature	
PFI1780w	hypothetical protein				1 probable transmembrane helix predicted for PFI1780w by TMHMM2.0 at aa 21-40	Signal anchor predicted for PFI1780w by SignalP 2.0 HMM (Signal peptide probabilty 0.162, signal anchor probability 0.762) with cleavage site probability 0.106 between residues 38 and 39
PFI1775w	hydrolase, putative				Weak hits to several lipase/phospholipases from several organisms. No pfam hit; ProfileScan hit to PS50187,Esterase/lipase/thioesterase active site serine.	
PFI1770w	hypothetical protein, conserved in P.falciparum				Signal anchor predicted for PFI1770w by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.962) with cleavage site probability 0.000 between residues -1 and 0	
PFI1765c	hypothetical protein			apicoplast	1 probable transmembrane helix predicted for PFI1765c by TMHMM2.0 at aa 10-29	
PFI1760w	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted for PFI1760w by TMHMM2.0 at aa 15-32	Signal anchor predicted for PFI1760w by SignalP 2.0 HMM (Signal peptide probabilty 0.001, signal anchor probability 0.684) with cleavage site probability 0.000 between residues 32 and 33
PFI1755c	hypothetical protein, conserved				Signal anchor predicted for PFI1755c by SignalP 2.0 HMM (Signal peptide probabilty 0.020, signal anchor probability 0.809) with cleavage site probability 0.008 between residues 33 and 34	1 probable transmembrane helix predicted for PFI1755c by TMHMM2.0 at aa 19-38
PFI1750c	hypothetical protein, conserved				Signal peptide predicted for PFI1750c by SignalP 2.0 HMM (Signal peptide probabilty 0.941, signal anchor probability 0.000) with cleavage site probability 0.849 between residues 21 and 22	
PFI1745c	hypothetical protein, conserved			apicoplast	Signal peptide predicted for PFI1745c by SignalP 2.0 HMM (Signal peptide probabilty 0.995, signal anchor probability 0.004) with cleavage site probability 0.655 between residues 24 and 25	2 probable transmembrane helices predicted for PFI1745c by TMHMM2.0 at aa 7-29 and 52-74
PFI1740c	hypothetical protein				1 probable transmembrane helix predicted for PFI1740c by TMHMM2.0 at aa 43-60	Signal anchor predicted for PFI1740c by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.998) with cleavage site probability 0.000 between residues 56 and 57
PFI1735c	ring exported protein, REX				1 probable transmembrane helix predicted for PFI1735c by TMHMM2.0 at aa 37-59	REX
PFI1730w	cytoadherence linked asexual protein 9(CLAG9)				Similar to Plasmodium falciparum cytoadherence linked asexual protein clag9 TR:Q9NAV4 (EMBL:AF286130) (1339 aa) fasta scores: E(): 0, 99.239% id in 657 aa.	CLAG9
PFI1725w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1725w by TMHMM2.0 at aa 13-35	
PFI1720w	Gametocyte-implicated protein (Fragment)					
PFI1715w	hypothetical protein, conserved					
PFI1710w	cytoadherence-linked protein				Identical to previously submitted Plasmodium falciparum sequence from chromosome 9 TR:Q25986 (EMBL:X95373) (617 aa) fasta scores: E(): 0, 99.666% id in 599 aa; linked to cytoadherence PMID:8943148	<b>attribution</b>:
PFI1705w	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1705w by TMHMM2.0 at aa 7-29 and 49-71	Signal anchor predicted for PFI1705w by SignalP 2.0 HMM (Signal peptide probabilty 0.023, signal anchor probability 0.973) with cleavage site probability 0.018 between residues 27 and 28
PFI1700c	vesicle transport protein, putative				Similarity to repeat region of Plasmodium falciparum aarp2 protein TR:Q94649 (EMBL:Y08924) (1360 aa) fasta scores: E(): 1.1e-15, 22.311% id in 874 aa. Similar to Rattus norvegicus vacuolar protein sorting homolog r-vps33a SWALL:Q63615 (EMBL:U35244) blast scores: E(): 3e-35, score: 380 22% id, and to Schizosaccharomyces pombe putative vacuolar protein sorting protein spbc1703.15C SWALL:Q9P7V6 (EMBL:AL136536) blast scores: E(): 9e-29, score: 324 24% id. Pfam match to PF00995, Sec1 family (2.60e-04)	
PFI1695c	small nuclear ribonucleoprotein (snRNP), putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1690c	hypothetical protein, conserved					
PFI1685w	cAMP-dependent protein kinase catalytic subunit				PfPKA	<b>attribution</b>:
PFI1680w	hypothetical protein, conserved				weak Pfam match to PF00789, UBX domain; SMART hit to SM00166, Domain present in ubiquitin-regulatory proteins	
PFI1675w	hypothetical protein, conserved					
PFI1670c	vacuolar ATP synthase subunit E, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1665w	uncharacterised trophozoite protein				Identical to Plasmodium falciparum hypothetical 10.4 kDa protein TR:Q9NFF9 (EMBL:AJ290939) (85 aa) fasta scores: E(): 3.1e-33, 100.000% id in 85 aa. Full length hypothetical protein reported as 10.4 kDa with EMBL entry no. AJ290939	
PFI1660w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1660w by TMHMM2.0 at aa 82-101	
PFI1655c	hypothetical protein, conserved					
PFI1650w	DNA excision-repair helicase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1645c	hypothetical protein, conserved			apicoplast	Signal peptide predicted for PFI1645c by SignalP 2.0 HMM (Signal peptide probabilty 0.987, signal anchor probability 0.012) with cleavage site probability 0.944 between residues 18 and 19	
PFI1640c	hypothetical protein, conserved					
PFI1635w	delta tubulin, putative				Similar to Homo sapiens tubulin delta chain tubd1 or tubD SWALL:TBD_HUMAN (SWALL:Q9UJT1) (453 aa) fasta scores: E(): 3.7e-20, 25.64% id in 468 aa, and to Paramecium tetraurelia putative delta-like tubulin dpt1 SWALL:Q9GRI0 (EMBL:AJ401299) (399 aa) fasta scores: E(): 4.9e-20, 36.53% id in 219 aa. Pfam match to entry PF00091 tubulin, Tubulin/FtsZ family, score 61.80, E-value 5.9e-15; FPrintScan hit to PR01224, Delta-tubulin signature	<b>attribution</b>:
PFI1630c	hypothetical protein, conserved					
PFI1625c	organelle processing peptidase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1620c	hyptohetical protein				Similar to Dictyostelium discoideum Spc98 protein spc98 SWALL:Q95ZG4 (EMBL:AJ318507) (812 aa) fasta scores: E(): 9.3e-15, 22.35% id in 653 aa, and to Schizosaccharomyces pombe spindle pole body component alp6 alp6 or spbc902.01c or spbc428.20C SWALL:ALP6_SCHPO (SWALL:Q9USQ2) (832 aa) fasta scores: E(): 3.1e-12, 24.71% id in 356 aa	
PFI1615w	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1615w by TMHMM2.0 at aa 944-963 and 970-992	
PFI1610c	calcylin binding protein-like, putative					
PFI1605w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1605w by TMHMM2.0 at aa 717-739	
PFI1600w	mRNA processing protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1595c	hypothetical protein, conserved					
PFI1590c	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1615c	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1615c by TMHMM2.0 at aa 669-691 and 741-763	
PFI1585c	30S ribosomal protein S6-like protein, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1580c	DHHC-type zinc finger protein, putative			apicoplast	4 probable transmembrane helices predicted for PFI1580c by TMHMM2.0 at aa 4-23, 30-52, 401-423 and 489-511	Similar to Homo sapiens cDNA flj14524 fis, clone nt2rm1001008 SWALL:BAB55104 (EMBL:AK027430) (215 aa) fasta scores: E(): 6.5e-09, 45.2% id in 73 aa, and to Mus musculus 1190004a01riK protein 1190004a01riK SWALL:Q9D0T6 (EMBL:AK004475) (235 aa) fasta scores: E(): 2.6e-08, 50% id in 62 aa. Pfam match to entry PF01529 zf-DHHC, DHHC zinc finger domain, score 75.50, E-value 1.1e-18; ProfileScan hit to PS50216, DHHC-type Zn-finger; BlastProDom hit to PD003041
PFI1575c	peptide release factor, putative				Similar to Aquifex aeolicus peptide chain release factor 1 prfa or aq_876 SW:RF1_AQUAE (O67032) (362 aa) fasta scores: E(): 1.5e-24, 31.818% id in 352 aa. Pfam match to entry PF00472 RF-1, Peptidyl-tRNA hydrolase domain, score 100.00, E-value 4.8e-26	<b>attribution</b>:
PFI1570c	aminopeptidase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1565w	conserved protein				Similar to Eimeria acervulina 19 kDa sporozoite antigen TR:Q24777 (EMBL:Z26584) (170 aa) fasta scores: E(): 8e-21, 38.182% id in 165 aa, and to Eimeria acervulina sporozoite antigen easz240/160 ceasz240 TR:Q03777 (EMBL:M59500) (180 aa) fasta scores: E(): 9.8e-21, 38.182% id in 165 aa. SMART hit to SM00392, Profilin /allergen	
PFI1560c	hypothetical protein, conserved				3 probable transmembrane helices predicted for PFI1560c by TMHMM2.0 at aa 39-61, 66-88 and 93-115	The last 2 exons are uncertain. Pfam match to PF01595, Domain of unknown function DUF21
PFI1555w	hypothetical membrane protein				5 probable transmembrane helices predicted for PFI1555w by TMHMM2.0 at aa 28-45, 60-78, 85-107, 127-149 and 162-181	
PFI1550c	hypothetical protein, conserved					
PFI1545c	proteasome precursor, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1540w	hypothetical protein, conserved					
PFI1535w	hypothetical protein, conserved					
PFI1530c	hypothetical protein, conserved			apicoplast	Signal anchor predicted for PFI1530c by SignalP 2.0 HMM (Signal peptide probabilty 0.005, signal anchor probability 0.937) with cleavage site probability 0.004 between residues 28 and 29	1 probable transmembrane helix predicted for PFI1530c by TMHMM2.0 at aa 12-31
PFI1525w	hypothetical protein, conserved				Moderate similarity to Mus musculus unknown TR:AAH06701 (EMBL:BC006701) (297 aa) fasta scores: E(): 0.028, 28.962% id in 183 aa. ProfileScan hit to PS50030, Ubiquitin-associated domain.	
PFI1520w	hypothetical protein					
PFI1515w	hypothetical protein, conserved			apicoplast	3 probable transmembrane helices predicted for PFI1515w by TMHMM2.0 at aa 3-25, 84-106 and 136-153	
PFI1510w	Nucleolar protein Nop52, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1505c	hypothetical protein, conserved				Similar to large number of elongation factors but clear outlier in a multiple alignment. Similar to Aeropyrum pernix elongation factor 1-alpha tuf or ape1844 SWALL:EF1A_AERPE (SWALL:Q9YAV0) blast scores: E(): 7e-10, score: 68 46% id. Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu family, score 66.20, E-value 1.9e-17; ScanProsite hit to PS00017	
PFI1835c	Nifu-like protein, putative				annotation, aeb, 051104; gene model defined after comparision with P. knowlesi	
PFI1500w	hypothetical membrane protein, conserved				10 probable transmembrane helices predicted for PFI1500w by TMHMM2.0 at aa 4-21, 233-252, 1528-1550, 1943-1965, 2003-2025, 2037-2059, 2359-2377, 2606-2628, 2633-2655 and 2662-2684	Signal anchor predicted for PFI1500w by SignalP 2.0 HMM (Signal peptide probabilty 0.247, signal anchor probability 0.729) with cleavage site probability 0.059 between residues 21 and 22
PFI1495w	hypothetical protein, conserved					
PFI1490c	large cyclophilin-like protein				Similar to Arabidopsis thaliana peptidylprolyl isomerase TR:Q9FJX0 (EMBL:AB013390) (595 aa) fasta scores: E(): 7.2e-09, 24.375% id in 640 aa; probably a cyclophilin family memmber but without PPIase or CsA-binding activity. ProfileScan hit to PS50072, Cyclophilin-type peptidyl-prolyl cis-trans isomerase profile.	
PFI1485c	diacylglycerol kinase, putative			apicoplast	2 probable transmembrane helices predicted for PFI1485c by TMHMM2.0 at aa 26-48 and 361-380	<b>attribution</b>:
PFI1480w	hypothetical protein, conserved				putative Myb DNA binding domain; Pfam match to entry PF00249 myb_DNA-binding, Myb-like DNA-binding domain, score 19.40, E-value 0.00077 SMART hit to 'SM00395, SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains; ProfileScan hit to PS50090, Myb DNA-binding domain repeat profile	
PFI1475w	merozoite surface protein 1, precursor				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1470c	leucine-rich repeat protein 8, LRR8			apicoplast	Pfam match to PF00560, Leucine Rich Repeat; SMART hit to SM00370	
PFI1465w	procollagen lysine 5-dioxygenase, putative				2 probable transmembrane helices predicted for PFI1465w by TMHMM2.0 at aa 486-508 and 529-551	Pfam match to entry PF02062 Lysyl_hydro, Lysyl hydrolase, score 18.00, E-value 6.9e-05
PFI1463w	hypothetical protein, conserved				annotation change, aeb, 150405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFI1460c	hypothetical protein, conserved				annotation change, aeb, 150405, gene model modified after TBLASTX comparison with P. knowlesi	
PFI1455c	hypothetical protein, conserved					
PFI1450c	hypothetical protein, conserved				With N-terminal similarity to Homo sapiens hypothetical 18.4 kDa protein dkfzp434i114 or dj1009e24.4 TR:Q9Y4P9 (EMBL:AL080154) (162 aa) fasta scores: E(): 1.5e-11, 41.600% id in 125 aa. No pfam hit; ProfileScan hit to PS50021, Calponin homology domain profile	
PFI1445w	High molecular weight rhoptry protein-2				Signal peptide predicted for PFI1445w by SignalP 2.0 HMM (Signal peptide probabilty 0.938, signal anchor probability 0.002) with cleavage site probability 0.706 between residues 19 and 20	<b>attribution</b>:
PFI1440w	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1440w by TMHMM2.0 at aa 300-317 and 337-356	No pfam match; Interpro hit to bipartite nuclear localisation signal
PFI1435w	RNA binding function, putative				Pfam match to RNA-recognition motif (RRM, RBD or RNP domain), PF00076 (8e-12); SMART hit (8.73e-06) to RNA-recognition motif (RRM) or RNP-1, SM00360; Interpro hit to IPR000504	annotation change, aeb, 150405, gene model modified after TBLASTX comparison to P. knowlesi. Exons 1 and 2 defined
PFI1430w	hypothetical protein, conserved					
PFI1425w	hypothetical protein, conserved					
PFI1420w	guanylate kinase, putative				Similar to Arabidopsis thaliana guanylate kinase gk-1 TR:Q9M683 (EMBL:AF204675) (387 aa) fasta scores: E(): 2.4e-21, 42.408% id in 191 aa. Pfam match to PF00625, Guanylate kinase; SMART hit to SM00072, Guanylate kinase homologues; ProfileScan hit to PS50052, Guanylate kinase domain profile;ScanProsite hit to PS00856, PS00856 Confirmed by InterPro eMOTIF pattern match.	<b>attribution</b>:
PFI1415w	Serine/Threonine protein kinase, putative				Pfam match to entry PF00069 pkinase, Protein kinase domain, score 39.70, E-value 6.4e-10; SMART hit to SM00220, Serine/Threonine protein kinases, catalytic domain; ProfileScan hit to PS50011, Protein kinase domain profile	<b>attribution</b>:
PFI1410c	hypothetical protein, conserved					
PFI1405c	hypothetical protein, conserved					
PFI1400c	hypothetical protein, conserved				Lysine-rich	
PFI1395w	hypothetical protein, conserved				4 probable transmembrane helices predicted for PFI1395w by TMHMM2.0 at aa 45-67, 88-110, 125-147 and 168-190	
PFI1390w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1390w by TMHMM2.0 at aa 21-43	
PFI1385c	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1385c by TMHMM2.0 at aa 60-82	
PFI1380c	hypothetical protein, conserved				glutamic acid-rich protein	
PFI1375w	cytochrome C oxidase, putative				polypeptide related to cytochrome C oxidase like proteins	<b>attribution</b>:
PFI1370c	phosphatidylserine decarboxylase				Signal anchor predicted for PFI1370c by SignalP 2.0 HMM (Signal peptide probabilty 0.007, signal anchor probability 0.971) with cleavage site probability 0.002 between residues 32 and 33	Plasmodium falciparum phosphatidylserine decarboxylase TR:Q9GPP8 (EMBL:AF312489) (353 aa) fasta scores: E(): 2e-129, 96.317% id in 353 aa. Similar to Plasmodium falciparum phosphatidylserine decarboxylase SWALL:Q9GPP8 (EMBL:AF312489) (353 aa) fasta scores: E(): 3e-140, 99.43% id in 353 aa. Pfam match to entry PF02666 PS_Dcarbxylase, Phosphatidylserine decarboxylase, score 117.30, E-value 2.9e-31
PFI1365w	cytochrome c oxidase subunit, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1360c	serine/threonine protein phosphatase, putative				Similar to Homo sapiens serine/threonine protein phosphatase 4 ppp4c or ppp4 or ppX SW:PPP4_HUMAN (P33172) (307 aa) fasta scores: E(): 5e-81, 62.278% id in 281 aa. Pfam match to PF00149, Ser/Thr protein phosphatase;SMART hit to SM00156, Protein phosphatase 2A FT homologues, catalytic domainProfileScan hit to PS50185, Metallo-phosphoesterase motif; FPrintScan hit to PR00114, Serine/threonine phosphatase family signature	<b>attribution</b>:
PFI1355w	hypothetical protein, conserved				asparagine-rich protein. No pfam hit; FPrintScan hit to PR01497, Shal voltage-gated K+ channel family signature	
PFI1350c	dynein light chain, putative				annotation change, 121105, aeb, gene model modified. Location of intron splice donor and acceptor sites revised resulting in a loss of 27 amino acids from the predicted protein sequence	1 probable transmembrane helix predicted for PFI1350c by TMHMM2.0 at aa 119-138
PFI1345c	hypothetical protein, conserved				annotation change, aeb, 150405, gene model modified after TBLASTX comparison with P. knowlesi	
PFI1340w	fumarate hydratase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1335w	hypothetical protein, conserved				Weak similarity to zinc finger domain, blast hit to HATPase_c domain at the N-terminus. Pfam match to PF00642, Zinc finger C-x8-C-x5-C-x3-H type (and similar);SMART hit to SM00356, zinc finger	
PFI1330c	hypothetical protein, conserved					
PFI1325w	CS domain protein, putative				Moderate similarity to Mus musculus 2700047n05riK protein 2700047n05riK TR:Q9D0V4 (EMBL:AK004388) (157 aa) fasta scores: E(): 4.4e-08, 26.897% id in 145 aa.	
PFI1320c	hypothetical protein, conserved				Distantly similar to Drosophila melanogaster Cg6443 protein cg6443 TR:Q9VKR2 (EMBL:AE003629) (299 aa) fasta scores: E(): 1.7e-06, 30.290% id in 241 aa	
PFI1315c	hypothetical protein, conserved				weak similarity to PFI0495w, 3.7e-23	annotation change, aeb, 291104, gene model modified, intron defined after N93, 381 amino acids removed from previous predicted protein as a result
PFI1310w	NAD synthase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1305w	hypothetical membrane protein, conserved				12 probable transmembrane helices predicted for PFI1305w by TMHMM2.0 at aa 13-35, 50-67, 88-110, 125-147, 159-181, 1031-1050, 1115-1137, 1178-1200, 1209-1231, 1251-1273, 1280-1297 and 1307-1326	
PFI1300c	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1300c by TMHMM2.0 at aa 644-663 and 690-712	
PFI1295c	monocarboxylase transporter				9 probable transmembrane helices predicted for PFI1295c by TMHMM2.0 at aa 7-29, 53-75, 82-101, 106-128, 141-163, 194-216, 351-373, 400-422 and 429-448	Similar to Plasmodium falciparum membrane transporter pfb0465C TR:O96186 (EMBL:AE001396) (457 aa) fasta scores: E(): 1.5e-18, 28.185% id in 518 aa. Similar to Sulfolobus solfataricus transport protein, permease sso2127 or c01003 SWALL:P95901 (EMBL:Y08256) (430 aa) fasta scores: E(): 0.029, 27.38% id in 157 aa. No pfam hit; ScanProsite hit to PS00589; Interpro hit to serine phosphorylation site in hpr protein
PFI1290w	protein kinase, putative				Moderately similar to Plasmodium falciparum serine /threonine protein kinase crk-3 TR:O44022 (EMBL:X87839) (300 aa) fasta scores: E(): 2.6e-07, 25.000% id in 284 aa. SMART hit to SM00219, Tyrosine kinase, catalytic domain; Pfam match to PF00069, Protein kinase domain	<b>attribution</b>:
PFI1285w	hypothetical protein, conserved			apicoplast		
PFI1280c	protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1275w	protein kinase, putative				Pfam match to PF02493, MORN repeat; Pfam match to PF00069, Protein kinase domain;Pfam match to PF00069 (1.4e-13), Protein kinase domain	
PFI1270w	hypothetical protein, conserved				Signal peptide predicted for PFI1270w by SignalP 2.0 HMM (Signal peptide probabilty 0.998, signal anchor probability 0.001) with cleavage site probability 0.899 between residues 20 and 21	
PFI1265w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1260c	Histone deacetylase				Identical to Plasmodium falciparum histone deacetylase hdac1 TR:Q9XYC7 (EMBL:AF091326) (449 aa) fasta scores: E(): 3.9e-193, 100.000% id in 449 aa. HMMPfam hit to PF00850, Histone deacetylase family	<b>attribution</b>:
PFI1255w	hypothetical protein, conserved				Similar to Arabidopsis thaliana zinc-binding protein-like TR:Q9FN32 (EMBL:AB007644) (129 aa) fasta scores: E(): 3.1e-20, 44.094% id in 127 aa and Similar to Arabidopsis thaliana hypothetical 14.8 kDa protein f11b9.15 TR:Q9C777 (EMBL:AC073395) (129 aa) fasta scores: E(): 9.6e-20, 48.031% id in 127 aa.	
PFI1250w	thioredoxin, putative				Similar to Ictalurus punctatus thioredoxin TR:Q9DGI3 (EMBL:AF293651) (107 aa) fasta scores: E(): 2.7e-09, 38.202% id in 89 aa. Weak similarities to Plasmodium falciparum thioredoxin 1 txr1 TR:Q9NIR2 (EMBL:AF202664) (104 aa) fasta scores: E(): 3.7e-08, 34.884% id in 86 aa. Pfam match to PF00085, Thioredoxin; ProfileScan hit to PS50223, Thioredoxin-domain (does not find all).	<b>attribution</b>:
PFI1245c	Protein phosphatase-beta				Plasmodium falciparum protein phosphatase-beta TR:O15920 (EMBL:U89025) (466 aa) fasta scores: E(): 1.9e-180, 99.142% id in 466 aa. Pfam match to PF00149, Ser/Thr protein phosphatase; SMART hit to SM00156, Protein phosphatase 2A homologues, catalytic domain.	
PFI1240c	prolyl-t-RNA synthase, putative			apicoplast	Similarities to prolyl-t-RNA synthases of bacterial origin; N-terminal signal peptide. Similar to Lactococcus lactis prolyl-trna synthetase pros or ll2127 SWALL:Q9CDT4 (EMBL:AE006441) (616 aa) fasta scores: E(): 1.6e-09, 35.21% id in 213 aa, and to Escherichia coli prolyl-trna synthetase pros or drpa or b0194 SWALL:SYP_ECOLI (SWALL:P16659) (572 aa) fasta scores: E(): 7.3e-08, 31.91% id in 235 aa. Pfam match to PF00587, tRNA synthetase class II (G, H, P, S and T)	<b>attribution</b>:
PFI1235w	methyltransferase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1230c	hypothetical protein, conserved				asparagine-rich	4 probable transmembrane helices predicted for PFI1230c by TMHMM2.0 at aa 12-34, 38-56, 63-82 and 97-116
PFI1225w	hypothetical protein, conserved					
PFI1220w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1220w by TMHMM2.0 at aa 74-96	
PFI1215w	splicesome-associated protein, putative				Moderately similar to Mus musculus splicing factor 3a, subunit 3, 60kd TR:AAH09141 (EMBL:BC009141) (501 aa) fasta scores: E(): 1.7e-24, 30.756% id in 595 aa. No significant pfam hit; SMART hit to SM00355, zinc finger;ProfileScan hit to PS50171, Zn-finger (C2H2) in matrin and other RNA-binding proteins	<b>attribution</b>:
PFI1210w	hypothetical protein, conserved					
PFI1205c	hypothetical membrane protein, conserved				Signal anchor predicted for PFI1205c by SignalP 2.0 HMM (Signal peptide probabilty 0.016, signal anchor probability 0.944) with cleavage site probability 0.007 between residues 27 and 28	13 probable transmembrane helices predicted for PFI1205c by TMHMM2.0 at aa 9-31, 36-58, 71-89, 104-126, 146-168, 188-210, 498-520, 891-913, 1022-1039, 1043-1065, 1086-1108, 1118-1138 and 1151-1173
PFI1200w	hypothetical protein, conserved					
PFI1195c	Thiamine pyrophosphokinase			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1190w	hypothetical protein, conserved					
PFI1185c	hypothetical protein, conserved					
PFI1180w	hypothetical protein, conserved				Signal anchor predicted for PFI1180w by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.927) with cleavage site probability 0.000 between residues 49 and 50	2 probable transmembrane helices predicted for PFI1180w by TMHMM2.0 at aa 37-59 and 270-289
PFI1175c	RNA-binding protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1170c	Thioredoxin reductase				Plasmodium falciparum thioredoxin reductase tr or gR SW:TRXB_PLAF5 (Q25861) (541 aa) fasta scores: E(): 5.7e-207, 100.000% id in 541 aa. Pfam match to PF02852, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domainPfam match to PF00070, Pyridine nucleotide-disulphide oxidoreductase;	<b>attribution</b>:
PFI1165c	hypothetical protein, conserved					
PFI1160w	Lipoate-protein ligase A type 2				PfLipL2	Gene model confirmed by cDNA sequencing. (M. Allary, pers comm) Lipoate ligase activity (LplA activity) was confirmed by functional complementation in a lipoylation deficient E. coli strain (LipB-, LplA-) (PMID:17244193)
PFI1155w	hypothetical protein, conserved				asparagine-rich protein	
PFI1150w	hypothetical protein, conserved					
PFI1145w	MAC/perforin, putative				1 probable transmembrane helix predicted for PFI1145w by TMHMM2.0 at aa 7-26	Similar to Plasmodium falciparum hypothetical 94.5 kDa protein mal4p2.23 TR:Q9U0J9 (EMBL:AL035475) (842 aa) fasta scores: E(): 2.4e-53, 26.878% id in 852 aa. Pfam match to PF01823, MAC/Perforin domain; SMART hit to SM00457, membrane-attack complex / perforin
PFI1140w	NADPH-cytochrome p450 reductase				Similar to Cunninghamella elegans NADPH-dependent cytochrome p450 oxidoreductase TR:Q9P4E2 (EMBL:AF195659) (710 aa) fasta scores: E(): 4.6e-18, 24.795% id in 730 aa. Similarity to Arabidopsis thaliana NADPH-ferrihemoprotein reductase f9n11.60 or at4g30210 TR:Q9SUM3 (EMBL:AL109796) (711 aa) fasta scores: E(): 6e-16, 26.747% id in 744 aa and also to several other NADPH-ferrihemoprotein reductases. Similar to Phaseolus aureus NADPH-cytochrome p450 reductase SWALL:NCPR_PHAAU (SWALL:P37116) (690 aa) fasta scores: E(): 2.3e-15, 26.82% id in 738 aa. Pfam match to PF00258, Flavodoxin; HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain	
PFI1135c	OTU-like cysteine protease, putative				weak Pfam hit to cysteine protease. Pfam match to PF02338, OTU-like cysteine protease; ProfileScan hit to PS50802, OTU domain.	
PFI1130c	DNA-directed RNA polymerase II, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1125c	3-oxoacyl-(acyl-carrier protein) reductase, putative			apicoplast	Similar to Bacillus subtilis 3-oxoacyl-(acyl-carrier protein) reductase fabG SW:FABG_BACSU (P51831) (246 aa) fasta scores: E(): 4.9e-42, 52.697% id in 241 aa, and to Brassica napus 3-oxyacyl-(acyl carrier protein) reductase bkr2 TR:CAC41363 (EMBL:AJ243084) (328 aa) fasta scores: E(): 3.5e-38, 47.541% id in 244 aa. Pfam match to PF00106, short chain dehydrogenase; ScanProsite hit to PS00061, Confirmed by InterPro eMOTIF pattern match.	<b>attribution</b>:
PFI1120c	hypothetical protein, conserved				2 probable transmembrane helices predicted for PFI1120c by TMHMM2.0 at aa 468-490 and 626-648	
PFI1115c	pre-mRNA splicing factor protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1110w	glutamate--ammonia ligase (glutamine synthetase), putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1105w	Phosphoglycerate kinase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1100w	para-aminobenzoic acid synthetase				Plasmodium falciparum para-aminobenzoic acid synthetase TR:Q9Y1K0 (EMBL:AF119554) (979 aa) fasta scores: E(): 0, 99.792% id in 963 aa. Pfam match to PF00117, Glutamine amidotransferase class-I; HMMPfam hit to PF00425, chorismate binding enzyme	<b>attribution</b>:
PFI1095w	hypothetical protein, conserved				annotation change, aeb, 150405, gene model modified after TBLASTX comparison with P. knowlesi	1 probable transmembrane helix predicted for PFI1095w by TMHMM2.0 at aa 196-218
PFI1090w	s-adenosylmethionine synthetase, putative				Pfam match to PF00438, S-adenosylmethionine synthetase, N-terminal domain; Pfam match to PF02772, S-adenosylmethionine synthetase, central domain; Pfam match to PF02773, S-adenosylmethionine synthetase, C-terminal domain	Identical to Plasmodium falciparum (isolate 3D7) s-adenosylmethionine synthetase maT TR:Q9GN14 (EMBL:AF097923) (402 aa) fasta scores: E(): 9.1e-162, 100.000% id in 402 aa.
PFI1085w	ubiquitin-like protein, putative				Pfam match to PF00240, Ubiquitin family; SMART hit to SM00213, Ubiquitin homologues	2 probable transmembrane helices predicted for PFI1085w by TMHMM2.0 at aa 852-871 and 891-913
PFI1080w	hypothetical protein, conserved				Distantly related to dynein heavy chain with 5 putative WD40-like repeat domains. Pfam match to PF00400, WD domain, G-beta repeat	
PFI1075w	hypothetical protein, conserved					
PFI1070c	BRIX domain, putative				2 probable transmembrane helices predicted for PFI1070c by TMHMM2.0 at aa 278-300 and 341-363	<b>attribution</b>:
PFI1065c	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted for PFI1065c by TMHMM2.0 at aa 7-29	
PFI1060w	hypothetical protein, conserved				Pfam match to PF00515, TPR Domain	
PFI1055w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI1055w by TMHMM2.0 at aa 69-91	
PFI1050c	Nifu-like protein, putative			apicoplast	Similar to Arabidopsis thaliana hypothetical 25.6 kDa protein TR:AAK44168 (EMBL:AF370353) (235 aa) fasta scores: E(): 0.00012, 28.834% id in 163 aa (except in first 70 amino acids in the N-terminal) ;single putative N-terminal transmembrane domain. HMMPfam hit (1.4e-09) to PF01106, NifU-like domain; BlastProDom hit to PD002830	1 probable transmembrane helix predicted for PFI1050c by TMHMM2.0 at aa 5-27
PFI1045w	hypothetical protein, conserved					
PFI1040c	hypothetical membrane protein, conserved				Asparagine-rich	6 probable transmembrane helices predicted for PFI1040c by TMHMM2.0 at aa 845-867, 893-915, 925-942, 1103-1125, 1494-1511 and 1553-1570
PFI1035w	hypothetical protein, conserved					
PFI1030c	ubiquitin conjugating enzyme E2, putative				Similar to Schizosaccharomyces pombe ubiquitin-conjugating enzyme e2 spbc1105.09 TR:Q9Y818 (EMBL:AL096851) (167 aa) fasta scores: E(): 7.6e-36, 56.875% id in 160 aa. Similar to Homo sapiens ubiquitin-conjugating enzyme e2 g2 ube2g2 SWALL:UBCJ_HUMAN (SWALL:P56554) blast scores: E(): 3e-37, score: 379 49% id. Pfam match to PF00179, Ubiquitin-conjugating enzyme	<b>attribution</b>:
PFI1025w	RNA-binding protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI1020c	Inosine-5'-monophosphate dehydrogenase				Identical to Plasmodium falciparum inosine-5'-monophosphate dehydrogenaseTR:O96387 (EMBL:AF035679) (510 aa) fasta scores: E(): 3.1e-188, 99.608% id in 510 aa	<b>attribution</b>:
PFI1015w	hypothetical protein, conserved				No pfam match, weak SMART hit to SM00516, Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p)	
PFI1010w	hypothetical protein, conserved			apicoplast		
PFI1005w	ADP-ribosylation factor-like protein, putative				Similar to Caenorhabditis elegans putative adp-ribosylation factor 2 f54c9.10 SW:ARF2_CAEEL (Q20758) (179 aa) fasta scores: E(): 2.7e-11, 31.319% id in 182 aa, and to Saccharomyces cerevisiae adp-ribosylation factor-like protein 1 arl1 or arf3 or ybr164c or ybr1216 SW:ARL1_YEAST (P38116) (183 aa) fasta scores: E(): 4.3e-11, 29.787% id in 188 aa. No pfam match; SMART hit to SM00010;ScanProsite hit to PS00017, PS00294	<b>attribution</b>:
PFI1000w	hypothetical protein, conserved					
PFI0995w	hypothetical protein, conserved				Signal peptide predicted for PFI0995w by SignalP 2.0 HMM (Signal peptide probabilty 0.935, signal anchor probability 0.000) with cleavage site probability 0.418 between residues 18 and 19	
PFI0990c	CS domain protein, putative			apicoplast		
PFI0985c	chaperone protein				1 probable transmembrane helix predicted for PFI0985c by TMHMM2.0 at aa 183-205	Strong C-terminal similarities to chaperones from several organisms. Similar to Neisseria meningitidis chaperone protein hscb or nma1598 SWALL:Q9JTW6 (EMBL:AL162756) (166 aa) fasta scores: E(): 0.0023, 41.42% id in 70 aa. HMMPfam hit to PF00226, DnaJ domain; SMART hit to SM00271, DnaJ molecular chaperone homology domain; ProfileScan hit to PS50076, dnaJ domain profile.
PFI0980w	hypothetical membrane protein, conserved				possibly related to GNS1/SUR1 family. HMMPfam hit to PF01151, GNS1/SUR4 family; ScanProsite hit to PS01188, PS01188 Confirmed by InterPro eMOTIF pattern match.	Signal anchor predicted for PFI0980w by SignalP 2.0 HMM (Signal peptide probabilty 0.001, signal anchor probability 0.725) with cleavage site probability 0.000 between residues 39 and 40
PFI0975c	hypothetical protein, conserved					
PFI0970c	TLD domain, putative				No pfam match; FPrintScan hit to PR01497, Shal voltage-gated K+ channel family signature	
PFI0965w	conserved protein, putative				Similar to Homo sapiens proline synthetase co-transcribed bacterial homolog protein prosC SWALL:POSC_HUMAN (SWALL:O94903) (275 aa) fasta scores: E(): 1.9e-05, 31.04% id in 248 aa, and to Arabidopsis thaliana putative proline synthetase associated protein f10m23.200 or at4g26860 SWALL:Q9SZ26 (EMBL:AL035440) (262 aa) fasta scores: E(): 1.9e-10, 32.6% id in 230 aa. Pfam match to PF01168, uncharacterized protein family UPF0001	
PFI0960w	dolichyl-diphosphooligosaccharide--protein-glyc ot ransferase,putative				2 probable transmembrane helices predicted for PFI0960w by TMHMM2.0 at aa 7-24 and 437-459	Signal peptide predicted for PFI0960w by SignalP 2.0 HMM (Signal peptide probabilty 0.776, signal anchor probability 0.224) with cleavage site probability 0.464 between residues 23 and 24
PFI0955w	sugar transporter				Similar to Plasmodium falciparum hexose transporter 1 ht1 or pfb0210C TR:O97467 (EMBL:AJ131457) (504 aa) fasta scores: E(): 1.2e-20, 24.066% id in 482 aa, and to Schizosaccharomyces pombe myo-inositol transporter 2 itr2 or spac20g8.03 SW:ITR2_SCHPO (P87110) (557 aa) fasta scores: E(): 1.3e-06, 22.705% id in 414 aa. Pfam match to PF00083, Sugar (and other)transporter	11 probable transmembrane helices predicted for PFI0955w by TMHMM2.0 at aa 51-73, 83-100, 107-129, 139-161, 181-203, 269-291, 304-326, 336-358, 365-387, 402-424 and 429-451
PFI0950w	protein disulfide isomerase, putative				1 probable transmembrane helix predicted for PFI0950w by TMHMM2.0 at aa 12-34	Signal anchor predicted for PFI0950w by SignalP 2.0 HMM (Signal peptide probabilty 0.030, signal anchor probability 0.951) with cleavage site probability 0.015 between residues 31 and 32
PFI0945w	hypothetical protein, conserved				Weakly similar to Caenorhabditis elegans hypothetical protein F29b9.5 f29b9.5 TR:AAK67231 (EMBL:U70849) (179 aa) fasta scores: E(): 2.8e-05, 32.800% id in 125 aa	
PFI0940c	PPPDE peptidase family, putative					
PFI0935w	DNAJ-like molecular chaperone protein, putative				Pfam match to PF00226, DnaJ domain; SMART hit to SM00271, DnaJ molecular chaperone homology domain; ScanProsite hit to PS00636, PS00636 Confirmed by InterPro eMOTIF pattern match.	6 probable transmembrane helices predicted for PFI0935w by TMHMM2.0 at aa 5-19, 32-49, 128-150, 163-180, 203-225 and 347-369
PFI0930c	Nucleosome assembly protein				Plasmodium falciparum nucleosome assembly protein b7 TR:Q9Y010 (EMBL:AJ238237) (269 aa) fasta scores: E(): 2.5e-94, 100.000% id in 269 aa	
PFI0925w	gamma-glutamylcysteine synthetase				Plasmodium falciparum gamma-glutamylcysteine synthetase gamma-gcS TR:Q9UB86 (EMBL:AJ007863) (1063 aa) fasta scores: E(): 0, 99.341% id in 1063 aa. HMMPfam hit to PF03074	<b>attribution</b>:
PFI0920c	Dihydrouridine synthase, putative			apicoplast	Signal anchor predicted for PFI0920c by SignalP 2.0 HMM (Signal peptide probabilty 0.034, signal anchor probability 0.947) with cleavage site probability 0.027 between residues 24 and 25	Pfam match to PF01207, Uncharacterized protein family UPF0034
PFI0915w	hypothetical protein, conserved				Weakly similar to Plasmodium reichenowi starp antigen precursor TR:Q26109 (EMBL:Z30339) (655 aa) fasta scores: E(): 8e-14, 23.577% id in 615 aa. Asperagine-rich hypothetical protein	
PFI0910w	DNA helicase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0905w	hypothetical protein				Signal anchor predicted for PFI0905w by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.894) with cleavage site probability 0.000 between residues 51 and 52	3 probable transmembrane helices predicted for PFI0905w by TMHMM2.0 at aa 24-46, 53-75 and 110-132
PFI0900w	hypothetical protein, conserved			apicoplast		
PFI0895c	Mov34 domain-containing protein				Similar to Schizosaccharomyces pombe hypothetical 33.3 kDa protein c4c3.07 in chromosome ii spbc4c3.07 TR:O43060 (EMBL:AL021730) (302 aa) fasta scores: E(): 7.7e-18, 30.847% id in 295 aa. Pfam match to PF01398, Mov34/MPN/PAD-1 family;SMART hit to SM00232, JAB/MPN domain; BlastProDom hit to PD005425	<b>attribution</b>:
PFI0890c	large ribosomal subunit protein L3, prokaryotic (50S)-like, putative				Similar to Mycoplasma capricolum 50s ribosomal protein l3 rplC SW:RL3_MYCCA (P10134) (223 aa) fasta scores: E(): 7.9e-25, 40.704% id in 199 aa, and to Bacillus subtilis 50s ribosomal protein l3 rplC SW:RL3_BACSU (P42920) (209 aa) fasta scores: E(): 4.2e-22, 40.865% id in 208 aa. Similar to Mycoplasma capricolum 50s ribosomal protein l3 rplC SWALL:RL3_MYCCA (SWALL:P10134) blast scores: E(): 1e-35, score: 376 40% id, and to Odontella sinensis chloroplast 50s ribosomal protein l3 rpl3 SWALL:RK3_ODOSI (SWALL:P49569) blast scores: E(): 9e-31, score: 335 38% id. Pfam match to PF00297, Ribosomal protein L3; ScanProsite hit to PS00474	<b>attribution</b>:
PFI0885w	heme binding protein, putative				1 probable transmembrane helix predicted for PFI0885w by TMHMM2.0 at aa 72-91	Similar to Schizosaccharomyces pombe hypothetical 16.3 kDa heme-binding protein spcc330.03C TR:O74875 (EMBL:AL031603) (145 aa) fasta scores: E(): 3.3e-08, 52.239% id in 67 aa. Pfam match (3.0e-06) to Heme_1 domain, PF00173; Interpro hit to IPR001199
PFI0880c	acid phosphatase, putative				2 probable transmembrane helices predicted for PFI0880c by TMHMM2.0 at aa 7-23 and 370-392	Signal anchor predicted for PFI0880c by SignalP 2.0 HMM (Signal peptide probabilty 0.119, signal anchor probability 0.793) with cleavage site probability 0.069 between residues 25 and 26
PFI0875w	Heat shock protein				Similar to Plasmodium falciparum heat shock protein pfgrP SWALL:Q07615 (EMBL:X69121) (652 aa) fasta scores: E(): 4.8e-217, 99.38% id in 652 aa	<b>attribution</b>:
PFI0870w	hypothetical protein, conserved					
PFI0865w	ATP binding protein, putative				Similar to Arabidopsis thaliana emb|cab92117.1 TR:Q9FMR4 (EMBL:AB007651) (291 aa) fasta scores: E(): 7.9e-32, 42.342% id in 333 aa. Pfam match to PF03029; ScanProsite hit to PS00017; Interpro hit to ATP/GTP binding site motif A (p-loop)	
PFI0860c	ATP-dependent RNA helicase, putative				Putative ATP-dependent RNA helicase protein. Similar to Arabidopsis thaliana ATP-dependent RNA helicase-like protein t12c14_10 TR:Q9LZQ9 (EMBL:AL162507) (726 aa) fasta scores: E(): 3e-153, 61.472% id in 693 aa, and to Schizosaccharomyces pombe putative pre-mrna splicing factor ATP-dependent RNA helicase Spbc16h5.10C spbc16h5.10C SW:DD15_SCHPO (O42945) (735 aa) fasta scores: E(): 3.3e-142, 56.667% id in 720 aa. Pfam match to PF00271,Helicase conserved C-terminal domain; SMART hit to SM00487, DEAD-like helicases superfamily, catalytic domain; SMART hit to SM00490, helicase superfamily c-terminal domain; ProfileScan hit to PS50136, DNA/RNA helicase domain (DEAD/DEAH box).	<b>attribution</b>:
PFI0855w	hypothetical protein, conserved					
PFI0850w	hypothetical protein, conserved				Weakly similar to Plasmodium falciparum Pfc0770C protein pfc0770C TR:O77382 (EMBL:Z98551) (1619 aa) fasta scores: E(): 3.7e-09, 21.490% id in 1396 aa	annotation change, aeb, 291104. Gene model modified, intron defined after S386, resulting in 27 amino acids removed from the predicted protein (SKKKKKLKKNNKMHKKNKKKLKNLYKK)
PFI0845w	hypothetical protein, conserved				4 probable transmembrane helices predicted for PFI0845w by TMHMM2.0 at aa 33-55, 75-97, 131-153 and 285-307	Signal anchor predicted for PFI0845w by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.602) with cleavage site probability 0.000 between residues 54 and 55
PFI0840w	hypothetical membrane protein, conserved				5 probable transmembrane helices predicted for PFI0840w by TMHMM2.0 at aa 31-53, 77-99, 106-128, 132-154 and 271-293	Signal anchor predicted for PFI0840w by SignalP 2.0 HMM (Signal peptide probabilty 0.002, signal anchor probability 0.997) with cleavage site probability 0.001 between residues 47 and 48
PFI0835c	N-glycosylase/DNA lyase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0830c	hypothetical protein, conserved					
PFI0825w	hypothetical protein, conserved				Asparagine-rich protein	
PFI0823w	hypothetical protein, conserved				annotation change, aeb. 300305, new gene model defined on the basis of TBLASTX comparison with P. knowlesi and FASTA searches	
PFI0820c	RNA-binding protein, putative				Similarity to several nuclear RNA-binding protein. Pfam match to PF00076, RNA recognition motif (eg. RRM, RBD, or RNP domain), SMART, ScanProsite and ProfileScan hit to RNA recognition motif	
PFI0815c	hypothetical protein, conserved				Similar to Drosophila melanogaster Cg9643 protein cg9643 TR:Q9VQJ8 (EMBL:AE003581) (219 aa) fasta scores: E(): 9.7e-14, 30.531% id in 226 aa. No pfam match, ProfileScan hit to PS50193, SAM (and some other nucleotide) binding motif)	
PFI0810c	apicoplast Ufd1 precursor				annotation change, aeb, 220607. Gene model modified in response to user comment. On the basis of 5' RACE evidence (EMBL EF016487). Exon1 modified	No pfam hit, ScanProsite hit to bacterial rhodopsin
PFI0805w	hypothetical protein, conserved				No Pfam hit, SMART hit to SM00184, Ring finger	
PFI0800c	hypothetical protein, conserved				4 probable transmembrane helices predicted for PFI0800c by TMHMM2.0 at aa 7-29, 88-110, 130-152 and 162-184	
PFI0795w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI0795w by TMHMM2.0 at aa 21-43	Signal anchor predicted for PFI0795w by SignalP 2.0 HMM (Signal peptide probabilty 0.152, signal anchor probability 0.803) with cleavage site probability 0.079 between residues 40 and 41
PFI0790w	thioredoxin, putative				ProfileScan hit to PS50223, Thioredoxin-domain (does not find all). Similarity to Plasmodium falciparum thioredoxin trX TR:Q9NFK9 (EMBL:AJ277839) (104 aa) fasta scores: E(): 9.3e-06, 29.670% id in 91 aa. Similar to Gallus gallus thioredoxin txN SWALL:THIO_CHICK (SWALL:P08629) (104 aa) fasta scores: E(): 1.6e-05, 28.57% id in 105 aa, and to Ophiophagus hannah thioredoxin txN SWALL:Q98TX1 (EMBL:AF321769) (105 aa) fasta scores: E(): 1.3e-08, 36.44% id in 107 aa	<b>attribution</b>:
PFI0785c	sugar transporter				11 probable transmembrane helices predicted for PFI0785c by TMHMM2.0 at aa 848-870, 877-896, 901-923, 936-958, 978-1000, 1163-1185, 1200-1222, 1243-1265, 1269-1291, 1304-1326 and 1341-1360	asparagine-rich C terminal; Pfam match to PF00083, Sugar (and other) transporter
PFI0780w	hypothetical protein, conserved					
PFI0775w	glycolipid transfer protein, putative				putative glycolipid transfer protein. Moderately similar to Drosophila melanogaster Cg6299 protein cg6299 TR:Q9VXV1 (EMBL:AE003499) (205 aa) fasta scores: E(): 0.00083, 27.041% id in 196 aa	
PFI0770c	hypothetical protein, conserved					
PFI0765w	hypothetical protein, conserved					
PFI0760w	hypothetical protein, conserved				asparagine-rich protein	
PFI0755c	6-phosphofructokinase, putative				Similar to Chlamydia pneumoniae fructose-6-p phosphotransferase pfka_2 or cpn0208 or cp0559 TR:Q9Z8X6 (EMBL:AE001607) (550 aa) fasta scores: E(): 2.2e-70, 41.142% id in 508 aa. The similarity exists upto 550 amino acids and there is no similarity in the last 700 amino acids. Pfam match to PF00365, Phosphofructokinase	<b>attribution</b>:
PFI0750c	hypothetical protein, conserved					
PFI0745w	hypothetical protein, conserved					
PFI0740c	ubiquitin conjugating enzyme, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0735c	NADH dehydrogenase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0730w	BSD domain, putative				Asparagine-rich protein	
PFI0725c	GINS complex subunit Psf3, putative					
PFI0720w	transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0715w	Zinc binding protein, putative				Similar to Caenorhabditis elegans Y54g11a.11 protein y54g11a.11 TR:Q9XVZ8 (EMBL:AL034488) (84 aa) fasta scores: E(): 1.6e-10, 42.683% id in 82 aa	
PFI0710c	hypothetical protein, conserved					
PFI0705w	hypothetical protein, conserved				several C-terminal conserved residues to Arabidopsis thaliana F3o9.32 protein f3o9.32 TR:Q9SA50 (EMBL:AC006341) (325 aa) fasta scores: E(): 5.6e-08, 30.744% id in 309 aa	
PFI0700c	Met-10+ like protein, putative			apicoplast	Signal peptide predicted for PFI0700c by SignalP 2.0 HMM (Signal peptide probabilty 0.997, signal anchor probability 0.002) with cleavage site probability 0.741 between residues 19 and 20	<b>attribution</b>:
PFI0695c	phospholipid or glycerol acyltransferase, putative			apicoplast	3 probable transmembrane helices predicted for PFI0695c by TMHMM2.0 at aa 7-26, 36-58 and 104-126	Similar to Borrelia burgdorferi 1-acyl-sn-glycerol-3-phosphate acyltransferase plsc or bb0037 SWALL:PLSC_BORBU (SWALL:Q59188) (250 aa) fasta scores: E(): 3.3e-05, 28.03% id in 214 aa, and to Nicotiana tabacum Jd1 jd1 SWALL:Q9FPM8 (EMBL:AF316320) (407 aa) fasta scores: E(): 6.1e-09, 31.01% id in 158 aa. Phospholipid and glycerol acyl transferase, SMART hit phosphate acyl transferase (PlsC) domain
PFI0690c	hypothetical protein, conserved					
PFI0685w	pseudouridylate synthase, putative			apicoplast	N-terminal similarity to a DRAP deaminase of S. cerevisiae and N-terminal signal peptide sequence. RNA pseudouridylate synthase, other Interpro hits include bipartite nuclear localisation signal and shal voltage-gated K+ channel	<b>attribution</b>:
PFI0680c	hypothetical protein, conserved			apicoplast	Signal peptide predicted for PFI0680c by SignalP 2.0 HMM (Signal peptide probabilty 0.995, signal anchor probability 0.000) with cleavage site probability 0.463 between residues 19 and 20	Weak hit (9.4e-03)to Arginyl T-RNA synthetase
PFI0675w	hypothetical protein					
PFI0670w	hypothetical protein, conserved			apicoplast	Signal peptide predicted for PFI0670w by SignalP 2.0 HMM (Signal peptide probabilty 0.848, signal anchor probability 0.032) with cleavage site probability 0.283 between residues 19 and 20	Similar to Plasmodium falciparum hypothetical 73.3 kDa protein mal4p2.18 TR:Q9U0K4 (EMBL:AL035475) (622 aa) fasta scores: E(): 8.3e-15, 25.301% id in 581 aa.
PFI0665w	hypothetical protein, conserved					
PFI0660c	protease, putative			apicoplast	Signal peptide predicted for PFI0660c by SignalP 2.0 HMM (Signal peptide probabilty 0.985, signal anchor probability 0.001) with cleavage site probability 0.891 between residues 18 and 19	<b>attribution</b>:
PFI0655c	hypothetical protein, conserved					
PFI0650c	hypothetical protein, conserved					
PFI0645w	EF-1B				Identical to Plasmodium falciparum translation elongation factor 1 beta ef-1B TR:Q9NI00 (EMBL:AF217234) (276 aa) fasta scores: E(): 2e-89, 100.000% id in 276 aa. EF-1 guanine nucleotide exchange domain	
PFI0640c	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI0640c by TMHMM2.0 at aa 7-29	Signal anchor predicted for PFI0640c by SignalP 2.0 HMM (Signal peptide probabilty 0.148, signal anchor probability 0.795) with cleavage site probability 0.101 between residues 21 and 22
PFI0635c	hypothetical protein, conserved					
PFI0630w	26S proteasome regulatory subunit, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0625c	hypothetical protein, conserved					
PFI0620w	hypothetical protein, conserved					
PFI0615w	hypothetical protein, conserved					
PFI0610w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI0610w by TMHMM2.0 at aa 28-45	weak hit to SAP domain, also SMART hit to DNA binding motif (bihelical) predicted to function chromosomal organisation
PFI0605c	hypothetical protein, conserved				Signal peptide predicted for PFI0605c by SignalP 2.0 HMM (Signal peptide probabilty 0.915, signal anchor probability 0.000) with cleavage site probability 0.720 between residues 20 and 21	Moderately similar to Arabidopsis thaliana hypothetical 50.3 kDa protein TR:Q9C5E0 (EMBL:AF360310) (447 aa) fasta scores: E(): 2.3e-08, 28.009% id in 457 aa with gaps
PFI0600w	hypothetical protein					
PFI0595c	hypothetical membrane protein, conserved				7 probable transmembrane helices predicted for PFI0595c by TMHMM2.0 at aa 4-23, 175-197, 228-250, 271-293, 308-330, 343-365 and 393-415	
PFI0590c	hypothetical protein, conserved					
PFI0585c	hypothetical protein, conserved				3 probable transmembrane helices predicted for PFI0585c by TMHMM2.0 at aa 303-325, 368-390 and 397-419	
PFI0580c	Falstatin, putative				Asparagine-rich protein	Signal peptide predicted for PFI0580c by SignalP 2.0 HMM (Signal peptide probabilty 1.000, signal anchor probability 0.000) with cleavage site probability 0.631 between residues 21 and 22
PFI0575c	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI0575c by TMHMM2.0 at aa 245-262	
PFI0570w	GTP-binding protein, putative			apicoplast	Similarity to Thermotoga maritima GTP-binding protein lepa or tm1623 SW:LEPA_THEMA (Q9X1V8) (621 aa) fasta scores: E(): 4.2e-37, 30.268% id in 859 aa. Similarity with several LepA like GTP-binding proteins with a non-conserved big chunk of amino acids in the middle of the protein, also with N-terminal signal sequence. Similarity starts at about 220 amino acid downstream of predicted protein. Contains KCDENGQV repeat array. PF00009 (9.7e-55) GTP-binding elongation factor Tu family, other Interpro hits include RasGTPase superfamily signature and ATP/GTP binding site motif A (P-loop)	Signal peptide predicted for PFI0570w by SignalP 2.0 HMM (Signal peptide probabilty 0.759, signal anchor probability 0.063) with cleavage site probability 0.337 between residues 25 and 26
PFI0565w	hypothetical protein, conserved				Asparagine-rich protein	
PFI0560c	hypothetical protein, conserved				Very weak similarity to Borrelia turicatae repeat motif protein Rept3 rept3 TR:Q9RGH8 (EMBL:AF128446) (207 aa) fasta scores: E(): 0.24, 25.455% id in 165 aa	
PFI0555c	hypothetical protein, conserved					
PFI0550w	cysteine repeat modular protein homologue, putative				Pfam hit to PF00051, Kringle domain; SMART hit to SM00130, Kringle domain	9 probable transmembrane helices predicted for PFI0550w by TMHMM2.0 at aa 2388-2410, 2417-2436, 2492-2514, 2575-2594, 2639-2661, 2688-2710, 2720-2737, 2754-2771 and 2781-2803
PFI0545w	hypothetical protein, conserved					
PFI0540w	hypothetical protein, conserved				Interpro hits to Immunoglobulin and MHC compolex domain and also to shal voltage-gated K+ channel	
PFI0535w	Phosphatidylinositol N-acetylglucosaminyltransferase, putative				5 probable transmembrane helices predicted for PFI0535w by TMHMM2.0 at aa 48-67, 82-99, 106-123, 138-157 and 164-186	Weakly similar to Arabidopsis thaliana putative phosphatidylinositol-glycan-class c f19i3.21 TR:O64761 (EMBL:AC004238) (303 aa) fasta scores: E(): 0.00044, 21.352% id in 281 aa. With 5 putative transmembrane domains.
PFI0530c	DNA primase, large subunit, putative				Similar to Mus musculus DNA primase large subunit prim2 SW:PRI2_MOUSE (P33610) (505 aa) fasta scores: E(): 1.1e-31, 30.943% id in 488 aa. Similarity to several DNA-primases, large subunit but no significant Interpro hit	<b>attribution</b>:
PFI0525w	nucleotide binding protein, putative			apicoplast	Signal peptide predicted for PFI0525w by SignalP 2.0 HMM (Signal peptide probabilty 0.773, signal anchor probability 0.201) with cleavage site probability 0.453 between residues 23 and 24	<b>attribution</b>:
PFI0520w	actin-like protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0515w	prenylated protein, putative				Similar to Schizosaccharomyces pombe hypothetical 22.7 kDa protein c13g1.11 in chromosome ii spbc13g1.11 TR:O60073 (EMBL:AL022600) (197 aa) fasta scores: E(): 1.6e-15, 28.000% id in 200 aa, and to Candida albicans probable snare protein ca49c10.18 TR:O94032 (EMBL:AL033497) (200 aa) fasta scores: E(): 1e-14, 30.435% id in 184 aa. ScanProsite hit to putative prenyl group binding site	
PFI0510c	hypothetical protein, conserved				Pfam match to PF00533, BRCA1 C Terminus (BRCT) domain; SMART hit to SM00292, breast cancer carboxy-terminal domain	
PFI0505c	selenide water dikinase, putative				weak hit to AIR synthase C-terminal domain. Pfam match to PF02769, AIR synthase related protein, C-terminal domain	
PFI0500w	hypothetical protein, conserved				Signal peptide predicted for PFI0500w by SignalP 2.0 HMM (Signal peptide probabilty 0.893, signal anchor probability 0.088) with cleavage site probability 0.677 between residues 28 and 29	1 probable transmembrane helix predicted for PFI0500w by TMHMM2.0 at aa 372-394
PFI0495w	hypothetical protein, conserved					
PFI0490c	hypothetical protein, conserved			apicoplast	FPrintScan hit to bacterial rhodopsin domain	<b>attribution</b>:
PFI0485c	hypothetical protein, conserved				SMART hit to SM00317, SET(Su(var)3-9, Enhancer-of-zeste, Trithorax)-domain of transcriptional regulators.	
PFI0480w	helicase with Zn-finger motif, putative				Similar to Schizosaccharomyces pombe putative helicase spcc550.03C TR:O59801 (EMBL:AL023592) (1213 aa) fasta scores: E(): 1.5e-38, 30.554% id in 1355 aa. HMMPfam hit to PF00270, DEAD/DEAH box helicase; SMART hit to SM00487, DEAD-like helicases superfamily, catalytic domain	<b>attribution</b>:
PFI0475w	small nuclear ribonucleoprotein (snRNP), putative				Similar to Homo sapiens small nuclear ribonucleoprotein sm d3 snrpd3 SW:SMD3_HUMAN (P43331) (126 aa) fasta scores: E(): 1.2e-08, 41.322% id in 121 aa. Pfam match to PF01423,small nuclear ribonucleoprotein (Sm protein)	
PFI0470w	FHA domain protein, putative				Asparagine-rich protein. Similar to Babesia microti seroreactive antigen bmn1-9b SWALL:Q9NIN1 (EMBL:AF206252) (428 aa) fasta scores: E(): 4.5e-26, 27.94% id in 408 aa, and to Dictyostelium discoideum homeobox-containing protein hbx-2 SWALL:O43989 (EMBL:AF036171) (534 aa) fasta scores: E(): 4.8e-24, 34.07% id in 405 aa. Pfam match to PF00498, FHA domain (Forkhead associoated domain)	
PFI0465c	hypothetical protein, conserved					
PFI0460w	hypothetical protein, conserved				proline rich protein. Distantly similar to Vigna unguiculata extensin class 1 protein precursor ext26G /TR:Q41707 (EMBL:X91836) (489 aa) fasta scores: E(): 4.3e-19, 30.657% id in 411 aa.	
PFI0455w	exoribonuclease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0450c	apoptosis-related protein, putative				Pfam hit of DUF122 domain (2.5e-05) / shal voltage-gated K+ channel family signature at C-terminus, thought to be related to programmed cell death. Moderately similar (mostly in the c-terminal region) to Drosophila melanogaster cg13072 protein pdcd-5 or cg13072 TR:Q9VUZ8 (EMBL:AE003528) (133 aa) fasta scores: E(): 1e-05, 37.634% id in 93 aa. Similar to Mus musculus programed cell death protein 5 pdcd5 or tfar19 SWALL:PCD5_MOUSE (SWALL:P56812) (126 aa) fasta scores: E(): 0.00017, 35.86% id in 92 aa, and to Arabidopsis thaliana F1n18.11 protein f1n18.11 SWALL:Q9FXG0 (EMBL:AC008030) (129 aa) fasta scores: E(): 9.7e-08, 42.85% id in 84 aa	BlastProDom hit to PD008148; FPrintScan hit to PR01497, Shal voltage-gated K+ channel family signature
PFI0445c	hypothetical protein, conserved				Signal peptide predicted for PFI0445c by SignalP 2.0 HMM (Signal peptide probabilty 0.998, signal anchor probability 0.000) with cleavage site probability 0.465 between residues 18 and 19	
PFI0440w	hypothetical protein, conserved				2 asparagine-rich domains	4 probable transmembrane helices predicted for PFI0440w by TMHMM2.0 at aa 98-120, 140-162, 167-184 and 483-505
PFI0435c	hypothetical protein, conserved				asparagine-rich domain	
PFI0430c	hypothetical protein, conserved				asparagine-rich domain	
PFI0425w	transporter, putative				Similar to Plasmodium falciparum adenine nucleotide translocase SWALL:Q25692 (EMBL:U04335) (301 aa) fasta scores: E(): 7.5e-07, 25.34% id in 217 aa. HMMPfam hit to PF00153, Mitochondrial carrier protein	4 probable transmembrane helices predicted for PFI0425w by TMHMM2.0 at aa 259-281, 323-345, 494-516 and 558-580
PFI0420c	tRNA pseudouridine synthase, putative				Similar to Saccharomyces cerevisiae pseudouridylate synthase 3 pus3 or deg1 or yfl001W SWALL:PUS3_YEAST (SWALL:P31115) (442 aa) fasta scores: E(): 7.5e-17, 37.25% id in 255 aa, and to Arabidopsis thaliana putative pseudouridine synthase f12g12.3 SWALL:Q9C5K6 (EMBL:AF360187) (446 aa) fasta scores: E(): 1e-11, 31.6% id in 250 aa. Pfam match to PF01416, tRNA pseudouridine synthase	
PFI0415c	ribosomal RNA methyltransferase, putative				Similarity with ribosomal RNA methyltransferases, Pfam hit with PF01728, Ftsj-like methyl transferase. Similar to Caenorhabditis elegans putative ribosomal RNA methyltransferase R74.7 r74.7 SWALL:RRM2_CAEEL (SWALL:Q22031) (337 aa) fasta scores: E(): 2.4e-13, 30.07% id in 419 aa, and to Drosophila melanogaster putative ribosomal RNA methyltransferase Cg5220 cg5220 SWALL:RRM1_DROME (SWALL:Q9VEP1) (302 aa) fasta scores: E(): 1.8e-12, 31.77% id in 384 aa. Pfam match to FtsJ-like methyltransferase	<b>attribution</b>:
PFI0410c	hypothetical protein, conserved				Could be consisting of 2 or more separate protein translation units	annotation change, aeb, 151104, gene modelmodified, reviewed in the light of the prediction from the SNAP algorithm
PFI0405w	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted for PFI0405w by TMHMM2.0 at aa 2-19 and 81-103	Signal peptide predicted for PFI0405w by SignalP 2.0 HMM (Signal peptide probabilty 0.915, signal anchor probability 0.038) with cleavage site probability 0.667 between residues 19 and 20
PFI0400c	hypothetical membrane protein, conserved				Signal anchor predicted for PFI0400c by SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.983) with cleavage site probability 0.000 between residues -1 and 0	6 probable transmembrane helices predicted for PFI0400c by TMHMM2.0 at aa 31-53, 84-101, 113-132, 159-181, 194-216 and 223-245
PFI0395w	hypothetical protein, conserved				blast hit (1.00e-09) with stykc domain	
PFI0390c	hypothetical membrane protein, conserved			apicoplast	Signal peptide predicted for PFI0390c by SignalP 2.0 HMM (Signal peptide probabilty 0.988, signal anchor probability 0.000) with cleavage site probability 0.738 between residues 20 and 21	6 probable transmembrane helices predicted for PFI0390c by TMHMM2.0 at aa 4-21, 95-114, 159-181, 243-260, 289-311 and 356-378
PFI0385c	S1/P1nuclease, putative				Similarity to bifunctional nucleases. Weak Pfam hit to PF02265, S1/P1 Nuclease E()=e-4; nuclease domain	1 probable transmembrane helix predicted for PFI0385c by TMHMM2.0 at aa 13-32
PFI0380c	formylmethionine deformylase, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0375w	ribosomal protein L35, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0370c	subunit of proteaseome activator complex, putative				Similar to Homo sapiens ki nuclear autoantigen TR:Q12920 (EMBL:U11292) (267 aa) fasta scores: E(): 1.5e-21, 32.453% id in 265 aa. Pfam match to PF02252, Proteasome activator pa28 beta subunit	
PFI0365w	hypothetical protein, conserved				Profilescan hit to PS50296, homology region to translational fideity controller sui1	
PFI0360c	hypothetical protein, conserved					
PFI0355c	ATP-dependent heat shock protein, putative				C-terminal half of protein is similar to prokaryotic ATP-dependent heat shock proteins. Similar to Rhizobium loti heat shock protein, ATP-dependent hsl protease ATP-binding subunit, hslu mll5004 SWALL:Q98CU1 (EMBL:AP003005) (443 aa) fasta scores: E(): 8.5e-54, 46.69% id in 439 aa, and to Escherichia coli, and ATP-dependent hsl protease ATP-binding subunit hslu or htpi or b3931 or z5478 or ecs4858 SWALL:HSLU_ECOLI (SWALL:P32168) (443 aa) fasta scores: E(): 2.1e-51, 46.56% id in 451 aa. No HMMPfam hit; SMART hit to SM00382, ATPases associated with a variety of cellular activities	
PFI0350c	hypothetical protein, conserved					
PFI0345w	GTPase activator, putative				TBC / Rab-GAP domain. Pfam match to PF00566, TBC domain; SMART hit to SM00164, Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs	
PFI0340c	hypothetical protein, conserved				2 potential downstrean exons possible	2 probable transmembrane helices predicted for PFI0340c by TMHMM2.0 at aa 511-530 and 542-561
PFI0335w	tubulin-specific chaperone, putative					
PFI0330c	hypothetical protein, conserved				Hypothetical protein. Pfam match to PF00560, Leucine Rich Repeat	level of similarity not sufficient to posite functionality or specify as a member of a conserved group
PFI0325c	hypothetical protein, conserved				Hypothetical protein. Pfam match to PF00642, Zinc finger C-x8-C-x5-C-x3-H type (and similar); SMART hit to SM00356, zinc finger. CCCH zinc finger proteins are often involved in cell cycle or growth phase regulation. The presence of a zinc finger domain suggests DNA binding capacity	
PFI0320w	arginase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0315c	hypothetical protein, conserved					
PFI0310w	Maf-like protein, putative				Hypothetical protein. Pfam match to PF00773, RNB-like protein	
PFI0305c	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted for PFI0305c by TMHMM2.0 at aa 7-27	Hypothetical protein with putative N-terminal transmembrane domain
PFI0300w	developmental protein, putative				Similar to Dictyostelium discoideum developmental protein Dg1118 dg1118 TR:O96552 (EMBL:AF081802) (192 aa) fasta scores: E(): 4.6e-16, 33.511% id in 188 aa	
PFI0295c	RNB-like protein, putative				Hypothetical protein with putative single transmembrane domain. PfamB (PB054968) match (7.4e-09) to RNB-like domain	2 probable transmembrane helices predicted for PFI0295c by TMHMM2.0 at aa 774-791 and 937-959
PFI0290c	beta subunit of coatomer complex, putative				Similar to Arabidopsis thaliana F18b13.7 protein f18b13.7 TR:Q9SSD5 (EMBL:AC009322) (920 aa) fasta scores: E(): 7.4e-81, 37.593% id in 939 aa. Similar to Homo sapiens coatomer beta' subunit copb2 SWALL:AAH00326 (EMBL:X70476) (906 aa) fasta scores: E(): 7.1e-80, 38.28% id in 888 aa. Pfam match to PF00400, WD domain, G-beta repeat; SMART hit to SM00320, WD40 repeats	<b>attribution</b>:
PFI0285w	hypothetical protein, conserved				SMART hit to SM00509, Domain in the N-terminus of transcription elongation factor S-II (and elsewhere)	
PFI0280c	autophagocytosis associated protein, putative				Thre is a potential exon-like sequence present between the exon 4 and exon 5 in the current gene model but not appropriate splice donor and acceptor site was found. Similar to Schizosaccharomyces pombe hypothetical 31.9 kDa protein c3b9.06c in chromosome ii spbc3b9.06C SWALL:O43035 (EMBL:AL022070) (275 aa) fasta scores: E(): 3.6e-12, 27.67% id in 271 aa, and to Saccharomyces cerevisiae autophagocytosis protein aut1 aut1 or ynr007c or n2040 SWALL:AUT1_YEAST (SWALL:P40344) (310 aa) fasta scores: E(): 1.5e-08, 27.18% id in 298 aa, and to Arabidopsis thaliana autophagocytosis protein aut1-like SWALL:Q9FKG9 (EMBL:AB012239) (334 aa) fasta scores: E(): 7.3e-07, 29.43% id in 299 aa	
PFI0275w	hypothetical protein, conserved				several WD40 domain pfam hits. Pfam match to PF00400, WD domain, G-beta repeat; SMART hit to SM00320, WD40 repeats	
PFI0270w	hypothetical protein, conserved				Signal anchor predicted for PFI0270w by SignalP 2.0 HMM (Signal peptide probabilty 0.023, signal anchor probability 0.744) with cleavage site probability 0.017 between residues 38 and 39	3 probable transmembrane helices predicted for PFI0270w by TMHMM2.0 at aa 20-37, 41-63 and 161-183
PFI0265c	RhopH3				Signal peptide predicted for PFI0265c by SignalP 2.0 HMM (Signal peptide probabilty 0.989, signal anchor probability 0.010) with cleavage site probability 0.877 between residues 24 and 25	Similar to Plasmodium yoelii high molecular weight rhoptry protein 3 pyrhoph3 /TR:Q9GNF1 (EMBL:AB044564) (882 aa) fasta scores: E(): 4.5e-129, 42.825% id in 878 aa. match to PfaDd2|1344c3|1999.12.28|EST|UFla 42..394 blast score 692 percent identity 100 none
PFI0260c	dynein heavy chain, putative				Pfam match to PF03028	
PFI0255c	mitochondrial carrier protein, putative				Significant pfam hit (4.3e-23) to mito_carr domain. Similar to Onchocerca gibsoni mitochondrial solute carrier SWALL:Q94634 (EMBL:U45997) blast scores: E(): 3e-12, score: 76 31% id, and to Arabidopsis thaliana putative mitochondrial carrier protein at2g30160 SWALL:O64731 (EMBL:AC004165) blast scores: E(): 2e-10, score: 70 30% id. MMPfam hit to PF00153, Mitochondrial carrier protein	<b>attribution</b>:
PFI0250c	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0245c	hypothetical protein, conserved					
PFI0240c	Cu2+ -transporting ATPase, Cu2+ transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0235w	replication factor A-related protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0230c	bacterial histone-like protein, putative			apicoplast	Signal peptide predicted for PFI0230c by SignalP 2.0 HMM (Signal peptide probabilty 0.986, signal anchor probability 0.000) with cleavage site probability 0.786 between residues 17 and 18	well conserved BHL domain (Bacterial Histone /Domain) peptide sequence.. N-terminal signal peptide. Pfam match to PF00216, Bacterial DNA-binding protein, E()=3.50e-17
PFI0225w	Ubiquitin carboxyl-terminal hydrolases family 2, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0220w	prefoldin subunit, putative				Similar to Caenorhabditis elegans probable prefoldin subunit 4 b0035.4 SW:PFD4_CAEEL (Q17435) (126 aa) fasta scores: E(): 1.3e-05, 32.479% id in 117 aa	
PFI0215c	signal peptidase, putative				1 probable transmembrane helix predicted for PFI0215c by TMHMM2.0 at aa 10-32	Similar to Arabidopsis thaliana probable microsomal signal peptidase 22 kDa subunit at3g05230 or t12h1.20 SWALL:Q9MA96 (EMBL:AF057144) (167 aa) fasta scores: E(): 1.6e-10, 35.22% id in 176 aa, and to Gallus gallus microsomal signal peptidase 23 kDa subunit spc22 SWALL:SP22_CHICK (SWALL:P28687) (180 aa) fasta scores: E(): 5.8e-08, 26.4% id in 178 aa
PFI0210c	hypothetical membrane protein, conserved			apicoplast	10 probable transmembrane helices predicted for PFI0210c by TMHMM2.0 at aa 229-251, 258-277, 287-309, 419-441, 469-491, 523-545, 560-582, 683-705, 715-737 and 1167-1189	
PFI0205w	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted for PFI0205w by TMHMM2.0 at aa 7-26	FPrintScan hit to PR01497, Shal voltage-gated K+ channel family signature
PFI0200c	adapter-related protein, putative				Similar to Arabidopsis thaliana epsilon-adaptin, putative f27m3_7 TR:Q9C6W3 (EMBL:AC074360) (933 aa) fasta scores: E(): 1.5e-58, 46.835% id in 474 aa, and to Homo sapiens adapter-related protein complex 4 epsilon 1 subunit ap4e1 SW:A4E1_HUMAN (Q9UPM8) (1137 aa) fasta scores: E(): 8.8e-49, 41.124% id in 445 aa. Pfam match to PF01602, Adaptin N terminal region	<b>attribution</b>:
PFI0195c	hypothetical protein, conserved				contains RabGAP/TBC domain. Pfam match to PF00566, TBC domain; SMART hit to SM00164, Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs.	
PFI0190w	ribosomal protein L32, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0185w	hypothetical protein, conserved			apicoplast	weak similarity (1.04e-03)to LCCL SMART domain.	Signal peptide predicted for PFI0185w by SignalP 2.0 HMM (Signal peptide probabilty 0.953, signal anchor probability 0.003) with cleavage site probability 0.869 between residues 20 and 21
PFI0180w	alpha tubulin				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0175w	hypothetical protein, conserved				Very weakly similar to Plasmodium falciparum hypothetical 118.9 kDa protein pfb0765W TR:O96246 (EMBL:AE001417) (980 aa) fasta scores: E(): 1.1e-08, 24.936% id in 778 aa	
PFI0170w	hypothetical protein, conserved				ProfileScan hit to PS50321, Asparagine-rich region; FPrintScan hit to PR00194, Tropomyosin signature	<b>attribution</b>:
PFI0165c	DEAD/DEAH box helicase, putative				Large protein with several pfam hits including DEAD, DUF19, Helicase C and OspEF like domains. Strong similarity with several helicases. Similar to Caenorhabditis elegans putative helicase C28h8.3 c28h8.3 SWALL:YP93_CAEEL (SWALL:Q09475) (1722 aa) fasta scores: E(): 9.8e-11, 26.88% id in 837 aa. Pfam match to PF00270, DEAD/DEAH box helicase; SMART hit to SM00487, DEAD-like helicases superfamily, catalytic domain	
PFI0160w	hypothetical protein, conserved				4 probable transmembrane helices predicted for PFI0160w by TMHMM2.0 at aa 643-665, 697-719, 748-770 and 939-961	Asparagine-rich protein. Very weakly similar to Plasmodium falciparum Pfc0425W protein pfc0425W TR:O77336 (EMBL:Z98547) (4550 aa) fasta scores: E(): 4.1e-29, 21.768% id in 3257 aa
PFI0155c	PfRab7, GTPase				Signal peptide predicted for PFI0155c by SignalP 2.0 HMM (Signal peptide probabilty 0.980, signal anchor probability 0.000) with cleavage site probability 0.865 between residues 16 and 17	<b>attribution</b>:
PFI0150c	hypothetical protein				3 probable transmembrane helices predicted for PFI0150c by TMHMM2.0 at aa 48-70, 124-146 and 150-167	Similar to Drosophila melanogaster Cg11857 protein cg11857 TR:Q9VBU6 (EMBL:AE003751) (203 aa) fasta scores: E(): 1.8e-16, 42.541% id in 181 aa.
PFI0145w	hypothetical protein, conserved				1 probable transmembrane helix predicted for PFI0145w by TMHMM2.0 at aa 97-119	
PFI0140w	hypothetical protein, conserved			apicoplast	Signal peptide predicted for PFI0140w by SignalP 2.0 HMM (Signal peptide probabilty 0.690, signal anchor probability 0.307) with cleavage site probability 0.352 between residues 23 and 24	2 probable transmembrane helices predicted for PFI0140w by TMHMM2.0 at aa 5-24 and 55-77
PFI0135c	papain family cysteine protease, putative				Signal peptide predicted for PFI0135c by SignalP 2.0 HMM (Signal peptide probabilty 0.871, signal anchor probability 0.001) with cleavage site probability 0.214 between residues 21 and 22	Pfam match to PF00112, Papain family cysteine protease; SMART hit to SM0645, Pept_C1, papain family cysteine protease; FPrintScan hit to PR00705, Papain cysteine protease (C1) family signature
PFI0130c	hypothetical protein, conserved in P.falciparum				Glutamic acid-rich region in C-terminus and with single transmembrane motif and a coiled coil structure identified using SMART.	1 probable transmembrane helix predicted for PFI0130c by TMHMM2.0 at aa 32-54
PFI0125c	protein kinase, FIKK family			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0120c	protein kinase, FIKK family			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0115c	protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0110c	protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0105c	protein kinase, FIKK family				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0100c	protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0095c	protein kinase, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0090c	hypothetical protein				single C-terminal transmembrane domain identified by TMHMM2. ProfileScan hit to PS50321, Asparagine-rich region	1 probable transmembrane helix predicted for PFI0090c by TMHMM2.0 at aa 385-407
PFI0085c	hypothetical protein, conserved in P.falciparum				2 probable transmembrane helices predicted for PFI0085c by TMHMM2.0 at aa 101-123 and 138-160	
PFI0080w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	STEVOR	2 probable transmembrane helices predicted for PFI0080w by TMHMM2.0 at aa 179-201 and 264-286
PFI0075w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	2 probable transmembrane helices predicted for PFI0075w by TMHMM2.0 at aa 5-24 and 323-345	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFI0070w	rifin				RIF	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFI0065w	rifin				1 probable transmembrane helix predicted for PFI0065w by TMHMM2.0 at aa 336-358	RIF
PFI0060c	hypothetical protein, conserved in P.falciparum				Similar to Plasmodium falciparum hypothetical 7.9 kDa protein mal1p4.06 TR:Q9NFB1 (EMBL:AL031747) (67 aa) fasta scores: E(): 6.2e-16, 70.149% id in 67 aa	
PFI0055c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	Similar to Plasmodium falciparum RifiN, mal1p4.04 rifiN TR:Q9NFB3 (EMBL:AL031747) (372 aa) fasta scores: E(): 5.3e-51, 47.042% id in 355 aa. similar to Rifins of P. falciparum. Pfam match to PF02009, Rifin/stevor family
PFI0050c	rifin				The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Pfam match to PF02009, Rifin/stevor family
PFI0045c	stevor				STEVOR	1 probable transmembrane helix predicted for PFI0045c by TMHMM2.0 at aa 254-276
PFI0040c	VARC-like pseudogene				varC-like pseudogene. Similar to Plasmodium falciparum pfemp1 fragment pfb0020C TR:O96110 (EMBL:AE001366) (440 aa) fasta scores: E(): 3.4e-71, 81.667% id in 240 aa	
PFI0035c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Similar to Plasmodium falciparum Pfc1115W protein pfc1115W TR:O97311 (EMBL:AL034559) (371 aa) fasta scores: E(): 5.1e-67, 66.404% id in 381 aa. Pfam match to PF02009, Rifin/stevor family
PFI0030c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Similar to Plasmodium falciparum Pfc1115W protein pfc1115W TR:O97311 (EMBL:AL034559) (371 aa) fasta scores: E(): 8.1e-58, 51.862% id in 376 aa. Pfam match to PF02009, Rifin/stevor family	RIF
PFI0025c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetatively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	Signal peptide predicted for PFI0025c by SignalP 2.0 HMM (Signal peptide probabilty 0.641, signal anchor probability 0.043) with cleavage site probability 0.316 between residues 24 and 25
PFI0020w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	1 probable transmembrane helix predicted for PFI0020w by TMHMM2.0 at aa 301-323	RIF
PFI0015c	rifin				1 probable transmembrane helix predicted for PFI0015c by TMHMM2.0 at aa 317-339	RIF
PFI0010c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Similar to Plasmodium falciparum Pfc1115W protein pfc1115W TR:O97311 (EMBL:AL034559) (371 aa) fasta scores: E(): 8.7e-63, 55.065% id in 385 aa. Pfam match to entry PF02009 Rifin_STEVOR, Rifin/stevor family, score 557.60, E-value 8.3e-164	RIF
PFI0005w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	cell-cell adhesion	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFI0002w	hypothetical proein conserved in P. falciparum				annotation change, aeb, 261104; gene model defined	
PFF1595c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1590w	rifin	molecular_function	biological_process	host cell plasma membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFF1585w	rifin pseudogene				RIF pseudogene	Putative RIF pseudogene, stop codon in exon 2
PFF1580c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1575w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFF1570w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF1565c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFF1560c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF1555w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFF1550w	stevor	molecular_function	biological_process	Maurer's cleft, membrane	stevor	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)
PFF1545w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PFF1540w	rifin pseudogene				unable to determine exon 1	RIF pseudogene
PFF1535w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane		
PFF1530c	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane	match to PfaDd2|1437c3|1999.12.28|EST|UFla 1..413 blast score 811 percent identity 100 none	
PFF1525c	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	membrane		
PFF1520w	hypothetical protein, conserved in P. falciparum	molecular_function	biological_process	cellular_component		
PFF1515c	erythrocyte membrane protein 1(PfEMP1) pseudogene				VAR pseudogene	<b>attribution</b>:
PFF1510w	hypothetical protein, conserved in Plasmodium falciparum					
PFF1505w	hypothetical protein, conserved					
PFF1500c	DEAD/DEAH box ATP-dependent RNA helicase, putative	ATP-dependent RNA helicase activity	RNA metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1495w	hypothetical protein, conserved					
PFF1490w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1485w	hypothetical protein, conserved				Conserved residues between codon positions 586-669	
PFF1480w	microtubule-associated protein ytm1 homologue, putative	cytoskeletal protein binding	cytoskeleton organization and biogenesis		There are 4 putative WD40 repeat domains	
PFF1475c	hypothetical protein, conserved				3 putative transmembrane domains detected by TMHMM	
PFF1470c	DNA polymerase epsilon, catalytic subunit a, putative	epsilon DNA polymerase activity	DNA-dependent DNA replication	epsilon DNA polymerase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1465w	hypothetical protein, conserved				Existence of the last exon is uncertain	
PFF1460c	hypothetical protein, conserved					
PFF1455c	hypothetical protein, conserved				There is a potential exon-like GC-rich area in the genomic sequence between the exons 3 & 4 in the current gene model; however, no appropriate 5'splice acceptor and 3'splice donor site was found for prediction of a small exon in the GC-rich exon-like region	
PFF1450w	sec14-like cytosolic factor or phosphatidylinositol/phosphatidylcholine transfer protein, putative	binding	vesicle-mediated transport	Golgi apparatus	Required for transport of secretory proteins from the golgi complex. catalyses the transfer of phosphatidylinositol and phosphatidylcholine between membranes in vitro.	
PFF1445c	cullin-like protein, putative		G1/S transition of mitotic cell cycle, regulation of progression through cell cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1440w	SET-domain protein, putative	protein domain specific binding			Possible multifunctional protein; Pfam hits to SET domain (1.4e-45); Bromodomain (1.4e-05); C3H4 Zn-finger- like PHD domain (6.0e-06)	
PFF1435w	hypothetical protein, conserved					
PFF1430c	amino acid transporter	amino acid transporter activity	amino acid transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1425w	RNA binding protein, putative	RNA binding			2 HMMSMART RNA recognition motifs found in the sequence; first RRM motif between amino acid positions 24- 102 (3.21e-04) and the second RRM between amino acid positions 132-206 (2.21e-16)	
PFF1420w	phosphatidylcholine-sterol acyltransferase precursor, putative	phosphatidylcholine-sterol O-acyltransferase activity	lipid metabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1415c	DNAJ domain protein, putative		response to heat, response to unfolded protein	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1410c	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1405c	hypothetical protein, conserved				Pfam hit (8.3e-06) to acetyltransferase domain (between amino acid positions 165-247) but FASTA and BLASTP did not produe any significant hit to any acetyltransferases	
PFF1400w	RAP protein, putative				annotation is based on pfam match	
PFF1395c	glutamyl-tRNA(Gln) amidotransferase subunit B, putative	glutamyl-tRNA(Gln) amidotransferase activity	glutamyl-tRNA aminoacylation, translation		Strong hit (3.6e-21) to pfam GatB_N domain; contains several repeat units	
PFF1390w	hypothetical protein, conserved					
PFF1385c	hypothetical protein, conserved				Contains possible DNA-binding domain; weak similarity (1.26e-01) to HMMSMART SANT domain; SANT domain has been referred in the literature as SWI3, ADA2, N-CoR and TFIIIB DNA-binding domains; InterPro weak hit to myb-DNA binding domain	
PFF1380c	hypothetical protein, conserved					
PFF1377w	hypothetical membrane protein, conserved				Obsolete product name: hypothetical protein	
PFF1375c	ethanolaminephosphotransferase, putative	ethanolaminephosphotransferase activity	lipid metabolic process	integral to membrane	4 putative transmembrane domains present; Pfam hit (4.6e-13) to CDP_OH_P_transf domain (CDP-alcohol phosphatidyltransferase);	<b>attribution</b>:
PFF1370w	P. falciparum PK4 protein kinase	eukaryotic elongation factor-2 kinase activity	protein amino acid phosphorylation		This pfPK4 is nearly identical to published pfPK4 sequence (SWALL:O43948 (EMBL:X94118); PMID: 9371731)) at the last 1123 amino acids at the C-terminal end except in the middle where there are 42 amino acids extra in the present gene model. It appears that the published pfPK4 could be a part of a continuous open reading frame as shown in this gene model. The published pfPK4 sequence starts with the following amino acid string sequence MKKRIRSSYK, which maps at amino acid position 1908;the additional 42 amino acids that are not there in the published sequence maps between amino acid positions 2520 and 2570 respectively with starting and ending amino acid strings of GDKNGLDGD and LDDNTKKLD respectively; There is possibility to have an alternate start site, 134 amino acids downstream of the present start site with the following amino acid string:MINILSND	<b>attribution</b>:
PFF1365c	HECT-domain (ubiquitin-transferase), putative				annotation is based on pfam match	previously identified frameshift at the C-terminal region of this protein between amino acid positions 8210 and 8220 (immediately after the amino acid sequence LSGGKKDKRNK) no longer present
PFF1360w	6-pyruvoyl tetrahydropterin synthase, putative	6-pyruvoyltetrahydropterin synthase activity	tetrahydrobiopterin biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1355w	hypothetical protein, conserved				Weak SMART hit (3.56e-02) to POP4 domain:a domain found in a protein subunit of human RNase MRP and RNase P ribonucleoprotein complexes and archaeal proteins.	
PFF1350c	acetyl-coenzyme a synthetase	acetate-CoA ligase activity	generation of precursor metabolites and energy		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1345w	transportin	protein carrier activity	protein import into nucleus	nuclear pore	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1340w	hypothetical protein, conserved					
PFF1335c	4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme		thiamin biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1330c	mitochondrial import inner membrane translocase subunit, putative	protein transporter activity	protein targeting to mitochondrion	mitochondrial inner membrane presequence translocase complex	2 probable transmembrane helices predicted by TMHMM2.0 at aa 71-93 and 168-185	<b>attribution</b>:
PFF1325c	c3h4-type ring finger protein, putative	zinc ion binding			Pfam and HMMSmart hit to zinc finger and RINg finger domains respectively	
PFF1320c	troponin c-like protein, putative				Hypothetical protein with similarity to troponin c- like proteins; weak pfam hit (2.0e-02) to EF-hand domain: a domain associated with signalling or buffering / transport proteins; existence of the first 2 exons uncertain	
PFF1315w	hypothetical protein with ankyrin repeats				There are 8 putative ankyrin repeat-like elements in the sequence as indicated by Pfam search results	
PFF1310c	hypothetical protein, conserved					
PFF1305w	hypothetical protein, conserved					
PFF1300w	pyruvate kinase, putative	pyruvate kinase activity	glycolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1295w	hypothetical protein, conserved				Conserved, human myg1-like protein	
PFF1290c	hypothetical protein, conserved					
PFF1285w	hypothetical protein, conserved					
PFF1280w	hypothetical protein, conserved				SMART domain hit to Sec14 (2.54e-07), a domain found in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p)	
PFF1275c	3-oxoacyl-(acyl-carrier-protein) synthase i/ii	3-oxoacyl-[acyl-carrier-protein] synthase activity, fatty-acid synthase activity		apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1270c	hypothetical protein, conserved				Asparagine-rich	
PFF1265w	oxidoreductase, short-chain dehydrogenase family, putative	oxidoreductase activity	metabolic process	membrane		
PFF1260c	hypothetical protein, conserved					
PFF1255w	hypothetical protein, conserved					
PFF1250w	hypothetical protein, conserved					
PFF1245c	hypothetical protein, conserved					
PFF1240w	poly(A) polymerase PAP, putative	polynucleotide adenylyltransferase activity	mRNA polyadenylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1235w	hypothetical protein, conserved					
PFF1230c	hypothetical protein, conserved					
PFF1225c	DNA polymerase 1, putative	DNA binding, DNA-directed DNA polymerase activity	DNA replication		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1220w	hypothetical protein, conserved				Weak blast hits to kinases, in addition to other hits to different proteins	
PFF1215w	hypothetical membrane protein, conserved				The existence of the first exon not certain; alternate model for the same gene could be single exon structure with the putative start codon 17 amino acid upstream of the 5' end of the second exon	
PFF1210w	hypothetical membrane protein, conserved				Weak hit (7.6e-02) to pfam PAP2 domain (type 2 phosphatidic acid phosphatase superfamily), contains 2 putative transmembrane domains	<b>attribution</b>:
PFF1205w	hypothetical protein, conserved					
PFF1200w	hypothetical protein, conserved				BLAST hit to AAA ATP-ase (4.0e-06) in schnipsel database, domain similarity is between residues 21 and 192; no significant hits to AAA family ATP-ases in FASTA or BLASTP searches	
PFF1195c	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFF1195c by DGPI v2.04 with cleavage site probability 0.232 near 600	Alternative exon-intron boundaries possible for the internal exons of this protein
PFF1190c	N-acetylglucosaminyl- phosphatidylinositol de-n-acetylase, putative	N-acetylglucosaminylphosphatidylinositol deacetylase activity	GPI anchor biosynthetic process	membrane	First exon is uncertain; the S. pombe, human and rat N-acetylglucosaminyl- phosphatidylinositol de-n-acetylasehomologues have a DUF158 pfam domain whereas this protein does not have a pfam hit	<b>attribution</b>:
PFF1185w	iswi protein homologue	ATP-dependent helicase activity, RNA binding	chromatin remodeling	chromatin remodeling complex	ISWI is a component of the nucleosome remodelling factor complex, a protein complex that facilitates the perturbation of chromatin structure in vitro in an ATP- dependent manner. The hydrolysis of ATP during the remodelling of chromatin is likely to be mediated by ISWI, releasing inorganic phosphate	
PFF1180w	anaphase-promoting complex subunit, putative			anaphase-promoting complex	With RING finger domain	
PFF1175c	hypothetical protein, conserved					
PFF1170w	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFF1170w by DGPI v2.04, no cleavage site predicted	annotation change, aeb, 300305, gene model modified after TBLASTX comparison with P. knowlesi. Coordinates of previous gene model (988978..988990,989033..989340)
PFF1165c	hypothetical protein, conserved					
PFF1160w	hypothetical protein, conserved					
PFF1155w	hexokinase	hexokinase activity	glycolysis	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1150w	ribonuclease H1 large subunit, putative	ribonuclease H activity	RNA catabolic process			
PFF1145c	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1140c	ATP-dependent DEAD box helicase, putative	ATP-dependent RNA helicase activity	RNA metabolic process			
PFF1135w	transcription or splicing factor-like protein, putative	RNA binding, RNA splicing factor activity, transesterification mechanism	RNA splicing		Contains Khomology RNA-binding domain, and a putative Zn-finger C2HC domain	
PFF1130c	superoxide dismutase, PfSOD2	superoxide dismutase activity	removal of superoxide radicals, response to oxidative stress		PfSOD2	<b>attribution</b>:
PFF1125c	RNA-binding protein mei2 homologue, putative	RNA binding	positive regulation of meiosis			
PFF1120c	hypothetical protein, conserved				Some domain similarity to human and rat jagged2 protein; Weak similarity to EGF-like domains; cysteine- rich protein	
PFF1115w	ferredoxin--NADP reductase, putative	ferredoxin reductase activity	electron transport	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1110c	hypothetical protein, conserved					
PFF1105c	chorismate synthase	chorismate synthase activity	chorismate biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1100c	hypothetical protein, conserved				Asparagine-rich	
PFF1095w	leucyl-tRNA synthetase, cytoplasmic, putative	leucine-tRNA ligase activity	leucyl-tRNA aminoacylation	cytoplasm	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1090c	hypothetical membrane protein, conserved			apicoplast		
PFF1085c	conserved hypothetical protein, expressed transcript				match to PfaDd2|0413c3|1999.12.28|EST|UFla 10..142 blast score 248 percent identity 99;	
PFF1080w	hypothetical protein, conserved					
PFF1075w	hypothetical protein, conserved					
PFF1070c	hypothetical protein, conserved				This conserved hypothetical protein has a long N- terminal extension in addition to the conserved amino acid residues	<b>attribution</b>:
PFF1065c	hypothetical protein, conserved					
PFF1060w	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFF1060w by DGPI v2.04, no cleavage site predicted	FEATURE_NAME needs adding
PFF1055c	hypothetical protein, conserved				There is similarity to smart HATPse_c domain but the similarity and results from other searches are not conclusive enough to annotate this protein as a histine kinase-like ATP-ases	
PFF1050w	nascent polypeptide associated complex alpha chain, putative		cotranslational protein folding	nascent polypeptide-associated complex	Pfam match to NAC domain	
PFF1045w	hypothetical protein, conserved					
MAL6_tRNA_Ser1	tRNA Serine				tRNA Ser anticodon TGA, Cove score 69.77	
PFF1040w	hypothetical protein, conserved					
PFF1035w	Pfs77 protein				The mRNA is expressed only in sexual stage in female gametocytes (PMID: 8538689)	
PFF1030w	hypothetical protein, conserved					
PFF1025c	pyridoxine biosynthetic enzyme pdx1 homologue, putative	catalytic activity	pyridoxine biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF1020c	hypothetical protein, conserved					
PFF1015w	hypothetical protein, conserved			apicoplast	Although Blastp evidence suggests that this protein could be related to RNA polymerase sigma factors from Anabaena and other genera, there is no further supporting evidence in FASTA search or HMMSmart and InterPro searches	
MAL6_tRNA_Leu1	tRNA Leucine				anticodon CAG, Cove score 51.91	
MAL6_tRNA_Ala1	tRNA Alanine				tRNA Ala, anticodon CGC, Cove score 70.00	
PFF1010c	hypothetical protein, conserved				Weak Pfam hit to DNAJ domain	
PFF1005w	hypothetical protein, conserved					
PFF1000w	cleavage stimulation factor subunit 1- like protein, putative	RNA binding	RNA processing	mRNA cleavage stimulating factor complex	Contains WD40 repeat domains	
PFF0995c	Merozoite surface protein 10, MSP10				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0990c	hypothetical protein, conserved					
PFF0985c	hypothetical protein, conserved					
PFF0980w	hypothetical protein, conserved					
PFF0975c	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFF0975c by DGPI v2.04 with cleavage site probability 0.696 near 484	<b>attribution</b>:
PFF0970w	splicing factor 3a subunit, putative		RNA splicing	spliceosome	SMART and ProfileScan hit to U1-type zinc finger domain in codons 51-85	<b>attribution</b>:
PFF0965c	hypothetical membrane protein, conserved					
PFF0960c	hypothetical protein, conserved					
PFF0955c	hypothetical protein, conserved					
PFF0950w	hypothetical protein, conserved					
PFF0945c	bi-functional enzyme PfACS10: long-chain fatty- acid Co-A ligase and oxalyl Co-A decarboxylase, putative	long-chain fatty acid transporter activity	glyoxylate cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0940c	cell division cycle protein 48 homologue, putative	ATPase activity	regulation of progression through cell cycle	microsome	annotation change, aeb, 310105, intron2 removed from gene model	
PFF0935c	hypothetical protein, conserved				MAL6P1.233 and MAL6P1.234 fused after contiguation of sequence; asparagine-rich protein; alternative start codon possible at 14 amino acids downstream of the present start codon	
PFF0930w	hypothetical protein, conserved					
PFF0925w	hypothetical protein, conserved				The first 2 exons are uncertain	
PFF0920c	hypothetical protein, conserved				Blast hit to AAA family of ATP-ases (2.0e-14), obtained using SMART web server; The existence of the last exon is less certain; There is possiblity that the last 9 exons might form a separate hypothetical gene	
PFF0915w	N-acetylglucosamine transferase	phosphatidylinositol N-acetylglucosaminyltransferase activity	GPI anchor biosynthetic process	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0910c	hypothetical protein, conserved				Although blasp shows similarity to DNA-directed RNA polymerase of P. falciparum, the evidence is not strong enough to annotate this gene product as similar to DNA- directed RNA polymerase	
PFF0905w	hypothetical protein, conserved					
PFF0900c	rhomboid protease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0895w	malate dehydrogenase, putative	malate dehydrogenase activity	tricarboxylic acid cycle	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0890c	hypothetical membrane protein, conserved				There is possibility of another small exon between the 3rd and 4th exon in the present gene model	
PFF0885w	60S ribosomal protein L27a, putative	structural constituent of ribosome	translation	large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0880c	hypothetical protein, conserved					
PFF0875w	hypothetical protein, conserved					
PFF0870w	hypothetical protein, conserved					
PFF0865w	histone h3	DNA binding	chromosome organization and biogenesis (sensu the Eukaryota research community)	nucleosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0860c	histone h2a	DNA binding	chromosome organization and biogenesis (sensu the Eukaryota research community)	nucleosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0855c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF0850c	stevor	molecular_function	antigenic variation	host cell plasma membrane, membrane	changed from RIFIN on the basis of orthologue analysis at PlasmoDB, confirmed by BLAST:25-02-04:AEB	Stevor
PFF0847w	Stevor, pseudogene				Stevor pseudogene	degenerate pseudogene with ten stop codons; similarity to Stevor exon2, no evidence for the existence of exon1
PFF0845c	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
PFF0840w	hypothetical protein, conserved					
PFF0835w	hypothetical protein, conserved				Although it is moderately similar to yeast nuclear segregation protein bfr1, the evidence is not strong enough to call this protein a bfr1 homologue	
PFF0830w	alpha adaptin-like protein, putative		vesicle-mediated transport	integral to membrane	Strong Pfam hit (2e-22;codon 25-837) to Adaptin N terminal region	<b>attribution</b>:
PFF0825c	mitochondrial import receptor subunit tom40				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0820w	hypothetical protein, conserved					
PFF0815w	malate:quinone oxidoreductase, putative	malate dehydrogenase (acceptor) activity	pyruvate metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0810c	hypothetical protein, conserved					
PFF0805c	hypothetical protein, conserved					
PFF0800w	hypothetical protein, conserved				Contains putative von Willebrand factor (vWF) type A domain between codons 336-528	
PFF0795w	hypothetical protein, conserved			apicoplast		
PFF0790c	hypothetical protein, conserved					
PFF0785w	hypothetical protein, conserved					
PFF0780w	hypothetical protein, conserved					
PFF0775w	pyridoxal kinase-like protein, putative	pyridoxal kinase activity	pyridoxine metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0770c	hypothetical protein, conserved				Weak HMMSmart hit to catalytic domain of Serine/threonine phosphatase family 2C between codons 1117- 1799	
PFF0765c	hypothetical protein, conserved				It is possible that the putative intron between the second and third exon in the present gene model does not exist and the reading frame containing the second exon, the third exon and the intervening sequences constituting the second exon of this gene	
PFF0760w	RNA and export factor binding protein, putative	RNA binding			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0755c	hypothetical protein, conserved					
PFF0750w	cyclin-dependent protein kinase, predicted	cyclin-dependent protein kinase activity	protein amino acid phosphorylation, regulation of progression through cell cycle		CMGC group (PMID:15479470)	<b>attribution</b>:
PFF0745c	ribonuclease, putative	ribonuclease activity	RNA processing		High similarity to Pfam:RNB (3.6e-10) domain between codons 1316-2514	<b>attribution</b>:
PFF0740c	Phosphatidylinositol glycan W, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0735w	hypothetical protein, conserved					
PFF0730c	enoyl-acyl carrier reductase	enoyl-[acyl-carrier-protein] reductase activity	fatty acid biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0725w	hypothetical protein, conserved					
PFF0720w	hypothetical membrane protein, conserved					
PFF0715c	endonuclease iii homologue, putative	endonuclease activity	DNA repair		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0710w	hypothetical protein, conserved				The existence of the third exon is not certain	
PFF0705c	hypothetical protein, conserved				Existence of the second exon is questionable; other possibility exits for the second exon structure	
PFF0700c	60S ribosomal protein L19, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	Similarities to several 60S ribosomal protein L19 and strong Pfam hit (4.5e-81) to ribosomal protein L19e between codons 15-162	<b>attribution</b>:
PFF0695w	hypothetical protein, conserved					
PFF0690c	organic anion transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0685c	Hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0680c	thiamin-phosphate pyrophosphorylase, putative	thiamin-phosphate diphosphorylase activity	thiamin biosynthetic process		The existence of the second exon is uncertain	<b>attribution</b>:
PFF0675c	myosin-like protein, putative	ATP binding, actin binding		myosin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0670w	hypothetical protein, conserved				This gene model could be divided into 2 separate hypothetical genes: the first exon makes the first gene and the last 2 exons make the second hypothetical gene	
PFF0665c	syntaxin binding protein, putative	protein transporter activity	protein secretion		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0660w	hypothetical protein, conserved			apicoplast		
PFF0655c	adapter-related protein, putative		vesicle-mediated transport	apicoplast, coated vesicle	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0650w	ribosomal protein L18, putative	structural constituent of ribosome	ribosome biogenesis and assembly	apicoplast, ribosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0645c	integral membrane protein			integral to membrane	7 probable transmembrane helices predicted by TMHMM2.0 at aa 115-146, 156-178, 255-272, 282-304, 510-532, 536-558 and 565-587	
PFF0640w	hypothetical protein, conserved					
PFF0635w	hypothetical protein, conserved					
PFF0630c	hypothetical protein, conserved				1 internal exon could be missing in this model	
PFF0625w	nucleolar GTP-binding protein 1, putative	GTP binding			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0620c	Pfs45-48 related protein, putative				GPI-Anchor Signal predicted for PFF0620c by DGPI v2.04, no cleavage site predicted	<b>attribution</b>:
PFF0615c	Plasmodium falciparum membrane protein pf12 precursor			membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0610c	PP-loop family protein, putative					
PFF0605c	hypothetical protein, conserved					
PFF0600w	hypothetical protein, conserved				N terminal similar to drosophila melanogaster cg12929 gene	annotation change, 300305,aeb, gene model modified on the basis of TBLASTX comparison with P knowlesi and on FASTA similarity searches
PFF0595c	leucine-rich repeat protein 5, LRR5			apicoplast	Contains Leucine-rich repeats	
PFF0590c	homologue of human HSPC025					
PFF0585c	hypothetical protein, conserved					
PFF0580w	hypothetical protein, conserved					
PFF0575c	hypothetical protein, conserved					
PFF0573c	60S ribosomal protein L39, putative				annotation change, 300305, new gene model defined on the basis of TblastX comparison with P. knowlesi	
PFF0570c	hypothetical protein, conserved					
PFF0565c	hypothetical protein, conserved					
PFF0560c	hypothetical protein, conserved				Contains putative SWIB domain; Pfam hit (4.6e-04) and HMMSmart hit (1.54e-03) to SWIB domain between amino acid residues 262 and 334	
PFF0555w	hypothetical protein, conserved					
PFF0550w	hypothetical protein, conserved					
PFF0545c	hypothetical protein, conserved					
PFF0540c	hypothetical membrane protein, conserved					
PFF0535c	trancription factor, putative		transcription			
PFF0530w	transketolase, putative	transketolase activity	pentose-phosphate shunt		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0525w	hypothetical protein, conserved					
PFF0520w	calcium-dependent protein kinase	calcium- and calmodulin-dependent protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0515c	hypothetical protein, conserved					
PFF0510w	histone H3, putative	DNA binding	chromatin assembly or disassembly, chromosome organization and biogenesis (sensu the Eukaryota research community)	nucleosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0505c	hypothetical protein, conserved	RNA binding			Contains putative RNA-recognition domain	
PFF0500c	step II splicing factor, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	spliceosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0495w	ribosomal protein L19-like protein, putative				Weak hits to ribosomal protein L19 protein from several organsims; also weak pfam hit to ribosomal protein L19	<b>attribution</b>:
PFF0490w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0485c	zinc finger, putative	nucleic acid binding		integral to membrane	Contains putative DHHC type zinc finger domain between codons 89-153; 4 probable transmembrane helices predicted by TMHMM2.0 at aa 20-42, 52-71, 145-167 and 187- 209	
PFF0480w	hypothetical protein, conserved					
PFF0475w	hypothetical protein					
PFF0470w	hypothetical protein, conserved					
PFF0465c	cardiolipin synthetase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0460w	hypothetical protein, conserved					
PFF0455w	citrate synthase-like protein, putative				Weak blastp hits to large number of prokaryotic citrate synthases. Also weak Pfam hit, e()=0.37, to PFAM:PF00285 Citrate synthase.	<b>attribution</b>:
PFF0450c	Zn2+ or Fe2+ permease	transporter activity	transport	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0445w	hypothetical protein, conserved				Asparagine-rich	
PFF0440w	hypothetical protein, conserved					
PFF0435w	ornithine aminotransferase	ornithine-oxo-acid transaminase activity	ornithine metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0430w	chaperone, putative	unfolded protein binding	protein folding			
PFF0425w	hypothetical protein, conserved					
PFF0420c	proteasome subunit alpha type 2, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0415c	hypothetical protein, conserved					
PFF0410w	hypothetical protein, conserved					
PFF0405c	hypothetical protein, conserved					
PFF0400w	hypothetical protein, conserved			apicoplast		
PFF0395c	WD repeat protein, putative				Contains putative WD40-like repeats	
PFF0390w	hypothetical protein, conserved					
PFF0385c	hypothetical protein, conserved					
PFF0380w	hypothetical protein, conserved				Asparagine-rich	
PFF0375c	hypothetical protein, conserved				Asparagine-rich	
PFF0370w	para-hydroxybenzoate--polyprenyltransferase (4- hydroxybenzoate octaprenyltransferase), putative	4-hydroxybenzoate octaprenyltransferase activity	ubiquinone metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0365c	G-protein associated signal transduction protein, putative				Significant Pfam hit (4.4e-29) to EXS family	
PFF0360w	uroporphyrinogen decarboxylase, putative	uroporphyrinogen decarboxylase activity	porphyrin biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0355c	hypothetical protein, conserved					
PFF0350w	MYND finger protein, putative	DNA binding	negative regulation of transcription from RNA polymerase II promoter		With putative MYND type Zn-finger Pfam domain in the C-terminus; The MYND motif is required for repression of basal transcription from the multidrug resistance 1 promoter by the t(8;21) fusion protein in human (PMID:9584201)	
PFF0345w	translation initiation factor IF-2, putative	translation initiation factor activity	translational initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0340c	glutaredoxin-like protein, putative				Significant hit to tigrfam:TIGR00365;TIGR00365: glutaredoxin-related protein;1.9e-43;codon 116-215	Codons 140-146 are possible active site residues.
PFF0335c	hypothetical protein					
PFF0330w	coatomer alpha subunit, putative				With putative 7 WD40 repeat domains	<b>attribution</b>:
PFF0325c	hypothetical protein, expressed, conserved				Asparagine-rich protein	match to Pfa3D7|2679|2000.12.28|EST|UTokyo 259..500 blast score 464 percent identity 100
PFF0320c	polypyrimidine tract binding protein, putative	poly-pyrimidine tract binding	RNA splicing		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0315c	hypothetical protein, conserved					
PFF0310w	hypothetical protein, conserved					
PFF0305c	ubiquitin-conjugating enzyme E2, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0300w	RNA-binding protein, putative	RNA binding				
PFF0295c	hypothetical protein, conserved					
PFF0290w	long chain polyunsaturated fatty acid elongation enzyme, putative		fatty acid elongation, unsaturated fatty acid	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0285c	DNA repair protein RAD50, putative	single-stranded DNA specific endodeoxyribonuclease activity	double-strand break repair		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0280w	hypothetical protein,conserved					
PFF0275c	nucleoside diphosphate kinase, putative	nucleoside diphosphate kinase activity	CTP biosynthetic process, GTP biosynthetic process, UTP biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0270c	cyclin dependent kinase binding protein, putative	protein binding	regulation of progression through cell cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0265c	calcium-binding protein, putative					
PFF0260w	serine/threonine protein kinase, Pfnek-5	protein serine/threonine kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0255c	hypothetical protein, conserved				Several weak FASTA hits to acylphosphatases	
PFF0250w	RNA binding protein, putative	RNA binding				
PFF0245w	50S ribosomal subunit L24, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Bacteria research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0240c	hypothetical protein					
PFF0235c	RAP protein, putative				annotation is based on pfam match	
PFF0230c	glyoxalase I, putative	lactoylglutathione lyase activity	methylglyoxal metabolic process	apicoplast	Also known as lactoylglutathione lyase / methylglyoxylase / aldoketomutase / ketone aldehyde mutase	<b>attribution</b>:
PFF0225w	DNA helicase, putative	ATP-dependent DNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0220w	hypothetical protein, expressed				Weak Pfam and HMMSmart hit to GYF (conserved Gly- Tyr-Phe residues) domain	
PFF0215w	hypothetical protein, conserved			apicoplast		
PFF0210w	hypothetical protein, conserved					
PFF0205w	hypothetical protein, conserved					
PFF0200c	hypothetical protein, conserved				match to Pfa3D7|4200|2000.12.28|EST|UTokyo 1..446 blast score 884 percent identity 100 none	
PFF0195c	hypothetical protein, conserved					
PFF0190c	hypothetical protein					
PFF0185c	hypothetical protein				FEAT_NAME=2270.t00276 and FEAT_NAME=2270.t00275 are merged with FEAT_NAME=2270.t00277	
PFF0180w	phenylalanyl-tRNA synthetase, putative	phenylalanine-tRNA ligase activity	phenylalanyl-tRNA aminoacylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0175c	hypothetical protein, conserved				Weak Pfam and HMMSmart hit to ARID (A/T-rich interaction domain)/BRIGHT DNA binding domain	
PFF0170w	calcium antiporter, putative	calcium, potassium:sodium antiporter activity	calcium ion transport	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0165c	hypothetical protein, conserved				Putative Zn-finger motif at the C-terminus	
PFF0160c	dihydroorotate dehydrogenase, mitochondrial precursor	dihydroorotate dehydrogenase activity	'de novo' pyrimidine base biosynthetic process	mitochondrial inner membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0155w	bcs1-like protein, putative	ATPase activity	protein complex assembly	mitochondrial inner membrane		
PFF0150c	hypothetical protein					
PFF0145w	hypothetical protein					
PFF0140c	hypothetical protein, conserved					
PFF0135w	hypothetical protein, conserved				Very weak HMMSmart hit (1.97e-01) to JmjC domain, a domain family that is part of the cupin mettaloenzyme superfamily	
PFF0130c	hypothetical protein, conserved					
PFF0125c	hypothetical protein				Pfam match to SAC3/GANP family(2.8e-08):an evolutionary conserved eukaryotic protein family involved in regulator of mitosis as a novel mediator nuclear protein export; BLASTP and FASTA did not produce any significant hit to SAC3/GANp family of protein	
PFF0120w	putative geranylgeranyltransferase	protein geranylgeranyltransferase activity	protein amino acid geranylgeranylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0115c	elongation factor G, putative	translation elongation factor activity	translational elongation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0110w	hypothetical protein					
PFF0105w	MYND finger domain protein				Pfam match to MYND finger(2.2e-07) domain	
PFF0100w	putative ATP dependent RNA helicase	ATP-dependent RNA helicase activity				
PFF0095c	hypothetical protein					
PFF0090w	hypothetical protein					
PFF0085w	hypothetical protein, conserved in P.falciparum					
PFF0080c	hypothetical protein, conserved					
PFF0075c	hypothetical protein, conserved in P.falciparum					
PFF0070w	erythrocyte membrane protein (PfEMP1) pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0065c	hypotherical protein conserved in Plasmodium falciparum					
PFF0060w	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 6, PfMC-2TM_6	molecular_function	biological_process	cellular_component	PfMC-2TM_6	
PFF0055w	hypothetical protein, conserved in Plasmodium falciparum					
PFF0050c	hypothetical protein, conserved in Plasmodium, falciparum	molecular_function	biological_process	cellular_component		
PFF0045c	rifin pseudogene				RIF pseudogene	putative RIF pseudogene, nonsense codon in exon 2
PFF0040c	rifin pseudogene				RIF pseudogene	
PFF0035c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF0030c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0025w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF0020c	erythrocyte membrane protein 1 (PfEMP1)-like protein				VAR-like	possible pseudogene
PFF0015c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PFF0010w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFF0005c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.187	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0138	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
MAL7P1.186	VAR-like erythrocyte membrane protein 1	molecular_function	antigenic variation	host cell plasma membrane, membrane	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	Due to an oversight on remapping this gene was temporarily thought to be a new model and was assigned systematic_id MAL7P1.211. Reverted to using the original name MAL7P1.186 on 010405. MAL7P1.211 retained as synonym
PF07_0136	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model
MAL7P1.350	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.185	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PF07_0134	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL7P1.184	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF07_0132	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL7P1.183	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	
PF07_0130	stevor	molecular_function	biological_process	Maurer's cleft, membrane	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)	stevor
MAL7P1.178	hypothetical protein, conserved in P.falciparum			apicoplast		
MAL7P1.177	predicted integral membrane protein, conserved in P. falciparum					
PF07_0129	acyl-coA synthetase, PfACS5	AMP binding, long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.176	erythrocyte binding antigen				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.175	protein kinase, putative, pseudogene				revised: re-annotated as a pseudogene; conceptual translation encodes protein kinase, putative	<b>attribution</b>:
MAL7P1.174	hypothetical protein, conserved in P.falciparum					
MAL7P1.173	hypothetical protein				GPI-Anchor Signal predicted for MAL7P1.173 by DGPI v2.04, no cleavage site predicted	
MAL7P1.172	hypothetical protein, conserved					
MAL7P1.171	hypothetical protein					
MAL7P1.170	ring stage expressed protein					
MAL7_tRNA_Thr2	tRNA Threonine				anticodon TGT, cove score 82.32	
MAL7_tRNA_Val1	tRNA Valine				anticodon TAC, cove score 76.94	
MAL7P1.167	hypothetical protein, conserved					
PF07_0127	hypothetical protein, conserved					
PF07_0126	hypothetical protein, conserved					
MAL7P1.164	adapter-related protein, putative		vesicle-mediated transport	clathrin coat of trans-Golgi network vesicle	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0125	hypothetical protein, conserved					
MAL7P1.163	hypothetical protein, conserved			apicoplast		
MAL7P1.162	dynein heavy chain, putative	microtubule motor activity	microtubule-based movement		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.161	dynein light chain, putative	microtubule motor activity	microtubule-based movement	microtubule associated complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0124	hypothetical protein, conserved					
MAL7P1.160	hypothetical protein, conserved					
PF07_0123	mRNA (N6-adenosine)-methyltransferase, putative	mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity	RNA modification		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0122	BRIX domain, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0121	NMD3 protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.159	antioxidant protein, putative	antioxidant activity	response to oxidative stress	apicoplast	PfAOP	<b>attribution</b>:
PF07_0120	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly. Results in the insertion of 11 amino acids. Current sequence 1492NNINNNNNNNNNNNYYDRTNDGNFSNGK1520, previously 1492IILIIIIIIIIIIITMI	
MAL7P1.158	signal recognition particle, putative		SRP-dependent cotranslational protein targeting to membrane	signal recognition particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.157a	hypothetical protein				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.157	hypothetical protein, conserved			apicoplast		
MAL7P1.156	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.155	hypothetical protein, conserved					
MAL7P1.154a	hypothetical protein, conserved				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.154	hypothetical protein, conserved					
PF07_0119	hypothetical protein, conserved					
MAL7P1.153	hypothetical protein, conserved					
PF07_0118	hypothetical protein, conserved					
PF07_0117	eukaryotictranslation initiation factor 2 alpha subunit, putative	translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 2 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0116	hypothetical protein, conserved					
PF07_0115	cation transporting ATPase, cation transporter			apicoplast, integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0114	hypothetical protein, conserved					
MAL7P1.152	hypothetical protein, conserved					
PF07_0113	hypothetical protein, conserved			apicoplast		
PF07_0112	proteasome subunit alpha type 5, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex, alpha-subunit complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.151	modification methylase-like protein, putative	DNA (cytosine-5-)-methyltransferase activity, DNA binding	DNA methylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.150	cysteine desulfurase, putative	cystathionine gamma-lyase activity	cysteine metabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.149	hypothetical protein, conserved			apicoplast	Existence of the intron is uncertain; alternative start site possible	
PF07_0111	hypothetical protein, conserved					
PF07_0110	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0109	hypothetical protein, conserved			apicoplast		
PF07_0108	hypothetical protein, conserved					
MAL7P1.147	ubiquitin carboxyl-terminal hydrolase, putative	ubiquitin thiolesterase activity	protein deubiquitination		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.146	hypothetical protein, conserved				Existence of small introns uncertain	annotation change, aeb, 170105, gene model modified, two amino acids differ from the previous predicted protein sequence, ILE1006 was ARG1006 LEU 1008 was VAL1008
MAL7P1.145	mismatch repair protein pms1 homologue, putative	ATP binding, damaged DNA binding	DNA replication, mismatch repair		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.144	protein kinase, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0107	hypothetical protein					
MAL7_28Sa					truncated by start of contig, probably joined to MAL7_28S	
MAL7_28S					truncated by end of contig; probably joined to MAL7_28a	
MAL7_ITS2					ITS2	
MAL7_5.8s					Hit to 5.8S_ribosomal_RNA_pfalcip 5..123 score: 172 percent id: 93.00 none	
MAL7_ITS1					ITS1	
MAL7_18Sa					probably truncated by end of contig	
MAL7_18S						
MAL7P1.142	hypothetical protein, conserved					
MAL7P1.141	hypothetical protein, conserved			apicoplast		
PF07_0106	hypothetical protein, conserved					
MAL7P1.139	mago nashi protein homolog, putative		sex determination		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.138	hypothetical membrane protein, conserved					
PF07_0105	exonuclease i, putative	5'-3' exonuclease activity	DNA recombination, mismatch repair	nucleus		
PF07_0104	kinesin-like protein, putative	ATP binding, microtubule motor activity	microtubule-based process	kinesin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.137	kelch protein, putative	actin binding	cytoskeleton organization and biogenesis		kelch domain containing proteins could have diverse functions. Scruin is an actin cross-linking protein; galactose oxidase catalyses the oxidation of the hydroxyl group at the C6 position in D-galactose; neuraminidase hydrolyses sialic acid residues from glycoproteins; and kelch may have a cytoskeletal function, as it is localised to the actin-rich ring canals that connect the 15 nurse cells to the developing oocyte in Drosophila [MEDLINE:96019249]. Nevertheless, based on the location of the kelch pattern in the catalytic unit in galactose oxidase, functionally important residues have been predicted in glyoxal oxidase [MEDLINE:94172626]; GO annotation is based on known function of Kelch-like protein in human	
MAL7P1.134	hypothetical protein, conserved					
MAL7P1.133	hypothetical protein, conserved				This hypothetical gene could be a part of the large hypothetical protein MAL1P1.134	
MAL7P1.132	hypothetical protein, conserved					
MAL7P1.131	hypothetical protein, conserved				Weak similarity to Sulfolobus tokodaii putative purine ntpase	
PF07_0103	chaperone, putative	unfolded protein binding		apicoplast	Contains DNAJ domain	<b>attribution</b>:
MAL7P1.130	3-demethylubiquinone-9 3-methyltransferase-like protein, putative	3-demethylubiquinone-9 3-O-methyltransferase activity	ubiquinone biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0102	hypothetical protein, conserved					
MAL7P1.129	hypothetical protein, conserved					
MAL7P1.127	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified. MALP1.128 incorporated into the terminal exon of MALP1.127	
MAL7P1.126	hypothetical protein, conserved					
PF07_0101	hypothetical protein, conserved				Hit to Pfa3D7|5235|2000.12.28|EST|UTokyo 283..388 score: 210 percent id: 100.00	
PF07_0100	hypothetical protein, conserved			apicoplast	Some domain similarity to ELAC1 proteins	
PF07_0099	hypothetical protein, conserved					
PF07_0098	dynactin 4, putative		microtubule-based movement	dynactin complex		
PF07_0097	hypothetical protein, conserved					
MAL7P1.125	hypothetical protein, conserved					
MAL7P1.124	hypothetical protein, conserved					
PF07_0096	hypothetical protein, conserved					
PF07_0095	tRNAHis guanylyltransferase, putative				annotation change, aeb, 141104; gene model modified. Exon 1 shortened and exons 2 - 4 defined. Note this gene model will be added to PlasmoDB in the next sheduled update.	
MAL7P1.123	hypothetical protein, conserved					
PF07_0094	hypothetical protein, conserved					
PF07_0093	hypothetical protein, conserved 					
PF07_0092	hypothetical protein, conserved					
PF07_0091	cell cycle control protein cwf15 homologue		RNA splicing, regulation of progression through cell cycle	spliceosome		
MAL7P1.122	conserved GTP-binding protein, putative	GTP binding	signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.120	hypothetical protein, conserved				One N-terminal 131 bp exon possible	
MAL7P1.119	hypothetical protein, conserved			apicoplast	Partial domain similarity to Plasmodium yoelii yoelii p235 rhoptry protein	
MAL7P1.118	PelOta protein homologue, putative		nuclear division			
PF07_0090	hypothetical protein, conserved					
MAL7P1.117	hypothetical protein, conserved					
PF07_0089	hypothetical protein, conserved			apicoplast		
PF07_0088	40S ribosomal protein S5, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.115	hypothetical membrane protein, conserved				One small intron possible	
MAL7P1.114	P36-like protein homologue, putative					
MAL7P1.113	DEAD box helicase, putative	ATP binding, ATP-dependent RNA helicase activity, RNA binding	RNA metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.112	hypothetical protein, conserved					
PF07_0087	hypothetical protein, conserved			apicoplast		
PF07_0086	hypothetical protein, conserved					
MAL7P1.111	hypothetical protein, conserved					
MAL7P1.110	Ham1-like protein, putative					
MAL7P1.109	hypothetical protein, conserved					
MAL7P1.108	hypothetical protein, conserved					
MAL7P1.107	hypothetical protein, conserved					
MAL7P1.106	hypothetical protein, conserved					
PF07_0085	ferrodoxin reductase-like protein	disulfide oxidoreductase activity, electron carrier activity	electron transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.105	hypothetical protein, conserved					
PF07_0084	hypothetical protein, conserved					
PF07_0083	hypothetical protein, conserved					
MAL7P1.104	3'-5' exoribonuclease Csl4 homolog, putative	3'-5'-exoribonuclease activity, 7S RNA binding	rRNA processing	exosome (RNase complex)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0082	hypothetical protein, conserved				Existence of an intron (210 bp) possible	
PF07_0081	hypothetical protein, conserved			apicoplast		
PF07_0080	40S ribosomal protein S10, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0079	60S ribosomal protein L11a, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	Hit to PfaDd2|1432c3|1999.12.28|EST|UFla 138..403 score: 519 percent id: 100.00	<b>attribution</b>:
PF07_0078	hypothetical protein, conserved					
MAL7P1.102	hypothetical protein, conserved					
PF07_0077	actin-related protein				orthology to actin-related protein 6, arp6, in T. gondi	
MAL7P1.100	serine/threonine protein kinase, Pfnek-4	ATP binding, protein serine/threonine kinase activity	protein amino acid phosphorylation, signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.99	hypothetical protein, conserved					
MAL7P1.98	hypothetical protein, conserved					
MAL7P1.97	hypothetical protein, conserved					
PF07_0076	hypothetical protein, conserved					
PF07_0075	hypothetical membrane protein, conserved				Hit to Pfa3D7|3929|2000.12.28|EST|UTokyo 497..290 score: 412 percent id: 100.00	
MAL7P1.95	hypothetical protein, conserved					
MAL7P1.94	prefoldin subunit 3, putative	unfolded protein binding	'de novo' protein folding	prefoldin complex		
MAL7P1.93	mitochondrial ribosomal protein S8, putative	structural constituent of ribosome	translation	mitochondrial small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.92	cysteine repeat modular protein 2 homologue			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.91	exported serine/threonine protein kinase	protein serine/threonine kinase activity	protein amino acid phosphorylation	membrane	PfEST	<b>attribution</b>:
MAL7P1.89	Dynein heavy chain, putative				It could be composed of 2 separate hypothetical proteins: first 8 exons forming one protein and the last 3 exons forming the second hypothetical protein; low similarity to P. falciparum reticulocyte-binding protein and dynein heavy chain	
MAL7P1.88	thioredoxin-like protein				Similarity to several thioredoxins of prokaryotic origin but this protein is much longer in size (449 residues) as compared to thioredoxins (length ~110 amino acids) that maps to amino acid positions between 220 and 310 in this hypothetical protein	
PF07_0074	hypothetical protein, conserved					
PF07_0073	seryl-tRNA synthetase, putative	ATP binding, serine-tRNA ligase activity	seryl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.87	hypothetical protein, conserved					
PF07_0072	calcium-dependent protein kinase 4	ATP binding, calcium ion binding, calmodulin regulated protein kinase activity	protein amino acid phosphorylation		PfCDPK4	<b>attribution</b>:
PF07_0071	queuine tRNA-ribosyltransferase; putative	queuine tRNA-ribosyltransferase activity, zinc ion binding	queuosine biosynthetic process, tRNA modification		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.86	transcription initiation factor iie, alpha subunit, putative	RNA polymerase II transcription factor activity	transcription initiation from RNA polymerase II promoter	transcription factor TFIIE complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.84	hypothetical protein, expressed, conserved				Hit to PfaDd2|0759c3|1999.12.28|EST|UFla 120..15 score: 210 percent id: 100.00	
MAL7P1.83	hypothetical protein, conserved					
MAL7P1.82	hypothetical membrane protein, conserved				annotation change, aeb, 170105, gene model modified.	
PF07_0070	drug metabolite transporter	transporter activity	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.81	eukaryotictranslation initiation factor 3 37.28 kDa subunit, putative	translation initiation factor activity	regulation of translational initiation	eukaryotic translation initiation factor 3 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0069	hypothetical protein, conserved					
PF07_0068	cysteine desulfurase, putative	cystathionine gamma-lyase activity	cysteine metabolic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.79	hypothetical protein, conserved				Partial similarity to Clostridium acetobutylicum glycosyltransferase domain containing protein cac2176 but pfam search does not produce significant hit to glycosyltransferase domain	
MAL7P1.78	hypothetical protein, conserved				Similarity to Bacillus subtilis DNA-directed RNA polymerase delta subunit is not strong enough to call this protein a homologue of rpoE	<b>attribution</b>:
MAL7P1.77	hypothetical protein, conserved					
MAL7P1.76	hypothetical protein, conserved			apicoplast		
PF07_0067	hypothetical protein, conserved				Partial similarity to Plasmodium falciparum Aarp1 protein; high similarity in the repeat region of the protein	<b>attribution</b>:
PF07_0066	hypothetical protein, conserved					
PF07_0065	zinc transporter, putative	zinc ion transporter activity	zinc ion transport	integral to plasma membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0064	drug/metabolite exporter, drug/metabolite transporter				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0063	hypothetical protein, conserved					
PF07_0062	GTP-binding translation elongation factor tu family protein, putative	GTP binding, translation elongation factor activity	translational elongation			
MAL7P1.75	mitochondrial ATP synthase F1, epsilon subunit, putative		ATP synthesis coupled proton transport	proton-transporting ATP synthase complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.74	hypothetical protein, conserved				Although moderately similar to Carsonella ruddii; ATP synthase gamma subunit, this pprotein does not produce any pfam hit to ATP synthases	
MAL7P1.73	calcium/calmodulin-dependent protein kinase, putative	ATP binding, calcium- and calmodulin-dependent protein kinase activity, calmodulin binding, protein serine/threonine kinase activity	protein amino acid phosphorylation, signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0061	hypothetical protein, conserved					
PF07_0060	hypothetical protein, conserved					
PF07_0059	4-nitrophenylphosphatase, putative	4-nitrophenylphosphatase activity	metabolic process			
MAL7_tRNA_Ser1	tRNA serine				anticodon GCT, cove score 66.98	
MAL7_tRNA_Leu1	tRNA Leucine				anticodon AAG,cove score 55.75	
MAL7_tRNA_Asp1	tRNA Asparatic acid				anticodon GTC; cove score 64.8	
PF07_0058	hypothetical protein, conserved					
PF07_0057	transcription elongation factor s-ii, putative	transcriptional elongation regulator activity	regulation of transcription from RNA polymerase II promoter	transcription elongation factor complex		
MAL7P1.69	calmodulin, putative	calcium ion binding	signal transduction		GPI-Anchor Signal predicted for MAL7P1.69 by DGPI v2.04, no cleavage site predicted	GPI-Anchor Signal predicted for MAL7P1.69 by DGPI v2.04, no cleavage site predicted
MAL7P1.68	Zinc finger, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0056	hypothetical protein, conserved					
PF07_0055	hypothetical protein, conserved					
PF07_0054	histone h2b, putative	DNA binding	chromatin assembly or disassembly	nucleosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0053	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified the updated sequence assembly resulted in the change of four amino acids in the predicted protein sequence. LYS88 previuosly ARG88, ASN99 previously ASP99, ILE97 previously MET97, TYR121 was PHE121	
PF07_0052	hypothetical protein, conserved					
MAL7P1.67	hypothetical protein, conserved				Moderate similarity to Synechocystis sp; hypothetical protein Sll0447 (SWALL:P74681 (EMBL:D90917))	
MAL7P1.66	hypothetical protein, conserved					
MAL7P1.65	hypothetical protein, conserved					
MAL7P1.64	hypothetical membrane protein, conserved					
MAL7P1.61	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	pseudo-VAR fragment
MAL7P1.59	hypothetical protein, conserved in P. falciparum					
MAL7P1.58	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 7.2, PfMC-2TM_7.2			apicoplast, membrane	PfMC-2TM_7.2	
MAL7P1.57	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
MAL7P1.56	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.55	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0051	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.52	RIF pseudogene, RIFIN pseudogene				Pseudo-RIF gene	
PF07_0050	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.50	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
MAL7P1.47	RIF pseudogene, RIFIN pseudogene				pseudo RIF gene	
PF07_0049	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
MAL7P1.43	RIF pseudogene, RIFIN pseudogene				pseudoRIF gene, putative	
PF07_0048	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)
MAL7P1.38	regulator of chromosome condensation protein, putative	chromatin binding	cell cycle, chromosome condensation	nucleus		
MAL7P1.37	sin3 associated polypeptide p18-like protein	transcription corepressor activity	regulation of transcription from RNA polymerase II promoter	histone deacetylase complex		
MAL7P1.36	hypothetical protein, conserved					
MAL7P1.35	hypothetical protein, conserved					
MAL7P1.34	hypothetical protein, conserved					
PF07_0047	cell division cycle ATPase, putative	ATPase activity	regulation of progression through cell cycle			
PF07_0046	50S ribosomal protein L1, putative	structural constituent of ribosome	translation	ribosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0045	hypothetical protein, conserved					
PF07_0044	hypothetical protein, conserved					
PF07_0043	60S ribosomal protein L34-a, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.33	hypothetical protein, conserved			apicoplast	Alternative start site possible	
MAL7P1.32	hypothetical protein, conserved			apicoplast	Alternative start site possible	
MAL7P1.31	hypothetical membrane protein, conserved			apicoplast		
PF07_0042	hypothetical protein, conserved					
PF07_0041	hypothetical protein, conserved					
MAL7P1.30	hypothetical protein, conserved					
MAL7P1.29	hypothetical protein, conserved					
MAL7P1.29a	hypothetical protein, conserved				annotation change, aeb, 011204, new gene model new sequence data	
PF07_0040	lysophospholipase-like protein, putative	hydrolase activity	phospholipid metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.28	ribonucleases p/mrp protein subunit, putative					
PF07_0039	hypothetical protein, conserved					
PF07_0038	Cg7 protein					
PF07_0037	Cg2 protein					
PF07_0036	Cg6 protein					
PF07_0035	cg1 protein					
MAL7P1.27	chloroquine resistance transporter	drug transporter activity	response to drug	membrane	PfCRT	<b>attribution</b>:
PF07_0034	Cg3 protein					
PF07_0033	Cg4 protein					
PF07_0032	Cg8 protein					
PF07_0031	heat shock protein 86 family protein		response to heat, response to unfolded protein			
PF07_0030	heat shock protein 86 family protein		response to heat, response to unfolded protein			
PF07_0029	heat shock protein 86		response to heat, response to unfolded protein			
MAL7P1.26	O-sialoglycoprotein endopeptidase, putative	O-sialoglycoprotein endopeptidase activity	O-sialoglycoprotein catabolic process	apicoplast		
PF07_0028	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0027	DNA-directed RNA polymerase 2 8.2 kDa polypeptide, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.25	cytoskeleton associated protein, putative					
MAL7P1.24	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.23	RAP protein, putative			apicoplast		
PF07_0026	ubiquitin-protein ligase E3, putative					
PF07_0025	hypothetical protein, conserved					
MAL7P1.22	hypothetical protein, conserved					
MAL7P1.209	AAA family ATPase, putative				annotation change, aeb, (011204) new sequence data 051104, new sequence data	
MAL7P1.208	rhoptry-associated membrane antigen, RAMA				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.207	hypothetical protein, conserved				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7_tRNA_Lys2	tRNA Lysine				anticodon TTT, cove score 85.39	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model
MAL7_tRNA_Lys1	tRNA Lysine				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	anticodon CTT, cove score 83.71
MAL7_tRNA_His1	tRNA Histidine				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	anticodon GTG, cove score 65.28
MAL7_tRNA_Thr1	tRNA Threonine				anticodon AGT, cove score 76.31	
MAL7P1.206	DNA mismatch repair enzyme, putative				muts homolog 2-related	annotation change, aeb, (011204) new sequence data 051104, new gene model
MAL7P1.205	hypothetical protein, conserved				annotation change, aeb, (011204), new sequence data 051104, new gene model	
MAL7P1.204	hypothetical protein, conserved				annotation change,aeb, (011204) new sequence data 051104, new gene model	weak similarity to Pfemp3-like protein Plasmodium berghei, 37% in 1816 aa, 6.1e-24
MAL7P1.320	Ribosomal protein, L37e, putative				annotation change, aeb, (091204) new sequence data 051104, new gene model	
MAL7P1.203	hypothetical protein, conserved				annotation change, aeb, (011204), new sequence data 051104, new gene model	
MAL7P1.202	hypothetical protein, conserved				annotation change, aeb, (011204), new sequence data 051104, new gene model	
MAL7P1.340	ATP synthase subunit c, putative				annotation change, aeb, (081204), new sequence data 051104, new gene model defined	annotation change, aeb, (081204), new sequence data 051104, new gene model defined
MAL7P1.300	hypothetical protein, conserved				annotation change, aeb, (081204), new sequence data 051104, new gene model	
MAL7P1.201	hypothetical protein, conserved				annotation change, aeb, (011204) new sequence data 051104, new gene model	Weak similarity to P. berghei RNA Helicase, PB105523.00.0, 52% id in 879 amino acids, 3.1e-8
PF07_0024	inositol phosphatase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0023	DNA replication licensing factor mcm7 homologue, putative	DNA-dependent ATPase activity	DNA replication initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.21	origin recognition complex subunit, putative	DNA replication origin binding	DNA replication initiation	nuclear origin of replication recognition complex	Annotation is based on FASTA and BLASTP evidence	<b>attribution</b>:
PF07_0022	hypothetical protein, conserved					
PF07_0021	hypothetical protein, conserved					
PF07_0020	hypothetical protein, conserved					
MAL7P1.20	peptide chain release factor, putative	translation release factor activity	translational termination	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0019	hypothetical protein, conserved					
PF07_0018	hypothetical membrane protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL7P1.19	ubiquitin-transferase, putative					
MAL7P1.18	serine/threonine protein kinase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF07_0017	hypothetical protein, conserved					
PF07_0016	hypothetical protein, conserved					
PF07_0015	hypothetical protein, conserved					
MAL7P1.17	hypothetical membrane protein, conserved				annotation change, aeb, 170105, In the version prior to the most recent assembly a possible frameshift existed. This has been resolved in the new assembly. Results in the loss of 24 amino acids from the predicted protein. The new predicted protein differs from the old between N2187 and N2248	<b>attribution</b>:
MAL7P1.16	hypothetical membrane protein, conserved				annotation change, aeb, 201204, gene model modified	
MAL7P1.15	hypothetical membrane protein, conserved					
PF07_0014	hypothetical protein, conserved					
MAL7P1.14	hypothetical protein, conserved					
MAL7P1.13	hypothetical protein, conserved				annotation change, aeb, 201204; new gene model defined, MAL7P.165 remapped onto MAL7P1.13	
MAL7P1.12	erythrocyte membrane-associated antigen			membrane	Weak hit to DEAD-like helicase domain (8.24e-03)	<b>attribution</b>:
PF07_0013	hypothetical protein, conserved					
MAL7P1.11	hypothetical protein, conserved					
PF07_0012	hypothetical protein, conserved					
PF07_0011	hypothetical protein, conserved					
PF07_0010	hypothetical protein, conserved					
MAL7P1.10	hypothetical protein, conserved					
MAL7_tRNA_Tyr1	tRNA Tyrosine				anticodon=GTA ; cove score= 74.68	GC-rich region
MAL7_tRNA_Ala1	tRNA Alanine				annotation change, aeb, 151104; New gene model added. Predicted using tRNA-Scan-SE.	anticodon = AGC ; cove scrore = 65.16
PF07_0009	chitinase precursor fragment, truncated				No GO terms added because this is a small 5' fragment of chitinase precursor gene, and thus would not be functional; could be a pseudo gene	
PF07_0008	hypothetical protein					
PF07_0007	hypothetical protein, conserved					
PF07_0006	starp antigen				GPI-Anchor Signal predicted for PF07_0006 by DGPI v2.04, no cleavage site predicted	Not identical to submited starp antigen sequence from T9/96 strain
PF07_0005	lysophospholipases-like protein, putative	hydrolase activity	phospholipid metabolic process		Similarity to lysophospholipases are not convincing but low similarity to several lysophospholipases	<b>attribution</b>:
MAL7P1.7	RESA-like protein					
MAL7P1.6	hypothetical protein, conserved in P.falciparum			apicoplast		
PF07_0004	hypothetical protein					
PF07_0003	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PF07_0002	hypothetical protein, conserved in P. falciparum					
MAL7P1.5	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein, PfMC-2TM_7.1				PfMC-2TM_7.1	
MAL7P1.4	hypothetical protein, conserved in P. falciparum					
MAL7P1.3	hypothetical protein, conserved in P. falciparum				high probability of a frameshift in exon 2	
MAL7P1.200	rifin				annotation change, aeb, (160405), gene model redefined as pseudogene as previously was defined with an incorrect acceptor site;	RIF
MAL7P1.229	Cytoadherence linked asexual protein				annotation change, aeb, (031204) gene model defined, new sequence data 051104, new gene model	
MAL7P1.228	Heat Shock 70 KDa Protein, (HSP70)				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	HSP70
MAL7P1.231	histidine rich protein II, hrpii				Warning: There are frameshifts in this region due to it highly repetetive nature. Sequence in this region is inder review	hrpii
MAL7P1.230	hypothetical protein, conserved in Plasmodium falciparum				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	annotation change, 031204, new sequence data 051104, new gene model
MAL7P1.227	stevor				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)
MAL7P1.226	rifin, pseudogene				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	RIF pseudogene
MAL7P1.225	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.224	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.223	stevor, putative				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.222	rifin				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model
MAL7P1.310	Stevor, putative, degenerate				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.220	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	
MAL7P1.219	rifin				RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL7P1.218	stevor				Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID: 12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID: 12477793); Review (PMID: 14747138)	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model
MAL7P1.217	rifin				RIF	annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model
MAL7P1.216	rifin				RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL7P1.215	rifin				annotation change, aeb, (011204) new sequence data 051104, new sequence data 051104, new gene model	RIF
MAL7P1.214	VAR pseudogene fragment, erythrocyte membrane protein 1 (PfEMP1) pseudogene fragment				VAR pseudogene	VAR exon 2 gene fragment
MAL7P1.213	rifin				RIF	annotation change, aeb, (0212040 new sequence data 051104, new gene model
MAL7P1.212	erythrocyte membrane protein 1 (PfEMP1)				PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	VAR
MAL13P1.356	erythrocyte membrane protein 1 (PfEMP1)				VAR	PfEMP-1 is expressed on the surface of infected red blood cells (PMID:14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID:10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID:10677532)(PMID:11915943)(PMID:11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID:11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID:9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID:12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID:12603733) (PMID:7624377)(PMID:11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID:14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID:11872399)
MAL13P1.535	rifin				RIF	annotation change, aeb, (200804) new sequence data 150704, new gene model
MAL13P1.530	rifin				annotation change, aeb, (250804) new sequence data 150704, new gene model	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL13P1.525	conserved hypothetical				annotation change, aeb, (250804) new sequence data 150704, new gene model	
MAL13P1.520	rifin				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
MAL13P1.515	rifin				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
MAL13P1.510	erythrocyte membrane protein 1 (PfEMP1), pseudogene				annotation change, aeb, (240804) new sequence data 150704, new gene model	VAR pseudogene
MAL13P1.505	stevor				annotation change, aeb, (200804) new sequence data 150704, new gene model	Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide.; Exon 2 - Three proposed transmembrane helices flanking polymorhic regions; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage.; var, rif, stevor expressed in this relative order.; In vitro, multiple transcripts are observed, although evidence that only a small subset, two or three transcripts per cell,are expressed thus suggesting a transcritional exclusion mechanism (PMID: 12477793).; Stably associated with Maurer's clefts (MC), membranous structures below the surface of the infected erythrocyte (IE) membrane that are involved in transport of parasite proteins to the IE surface (PMID:12477793).; Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID:12368866); Spliced transcripts observed in gametocytes(PMID:12477793); Review (PMID: 14747138)
MAL13P1.500	rifin				annotation change, aeb, (240804) new sequence data 150704, new gene model	RIF
MAL13P1.495	rifin				RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL13P1.490	StevoR				stevor	annotation change, aeb, (200804) new sequence data 150704, new gene model
MAL13P1.485	acyl-coa ligase antigen				HMMPfam hit to PF00501, AMP-binding enzyme, score 1.6e-49	annotation change, aeb, (200804) new sequence data 150704, new gene model
MAL13P1.480	histidine-rich protein iii, hrpiii				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.475	hypothetical protein conserved in P. falciparum				annotation change, aeb, (230804) new sequence data 150704, new gene model	
MAL13P1.470	hypothetical protein				annotation change, aeb, (230804) new sequence data 150704, new gene model	
MAL13P1.465	hypothetical protein				annotation change, aeb, (240804) new sequence data 150704, new gene model	
MAL13P1.460	conserved hypothetical protein				annotation change, aeb, (230804) new sequence data 150704, new gene model	
MAL13P1.455	conserved hypothetical protein				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.450	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (230804) new sequence data 150704, new gene model	
MAL13P1.440	hypothetical protein, pseudogene				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13_5.8SrRNA					not associated with an rRNA operon	aeb,ngm
MAL13P1.435	conserved hypothetical protein				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.430	conserved hypothetical protein, pseudogene				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.425	hypothetical protein				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.420	hypothetical protein conserved				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.415	hypothetical protein, pseudogene				very low blast P hit to heme maturase	annotation change, aeb, (200804) new sequence data 150704, new gene model
MAL13P1.413	membrane associated histidine-rich protein, MAHRP-1				annotation change, aeb, (200804) new sequence data 150704, new gene model	MAHRP1
MAL13_tRNA_Gly1	tRNA Glycine				anticodon= GCC ; cove score = 65.57	annotation change, aeb, (200804) new sequence data 150704, new gene model
MAL13_tRNA_Cys1	tRNA Cysteine				annotation change, aeb, (200804) new sequence data 150704, new gene model	anticodon=GCA, cove score = 72.18
MAL13_tRNA_Arg3	tRNA Arginine				annotation change, aeb, (200804) new sequence data 150704, new gene model	anticodon=CCT ; cove score =69.82
MAL13_tRNA_Trp1	tRNA Tryptophan				annotation change, aeb, (200804) new sequence data 150704, new gene model	anticodon=CCA; cove score=70.69
MAL13_tRNA_Arg2	tRNA Arginine				anticodon = ACG; cove score = 70.22	annotation change, aeb, (220804) new sequence data 150704, new gene model
PF13_0361	hypothetical protein, conserved			apicoplast		
MAL13P1.352	hypothetical protein, conserved					
MAL13P1.351	hypothetical protein, conserved			membrane	hypothetical protein, three transmembrane domains	
MAL13P1.350	hypothetical protein, conserved					
MAL13P1.349	hypothetical protein					
PF13_0360	hypothetical protein, conserved					
MAL13P1.348	hypothetical protein, conserved			membrane	hypothetical protein, transmembrane domains	
MAL13P1.347	hypothetical protein, conserved					
MAL13P1.346	DNA repair endonuclease		DNA repair		Good Pfam hit to PF02732 ERCC4 domain	<b>attribution</b>:
PF13_0359	mitochondrial carrier protein, putative	binding	transport	mitochondrial inner membrane	signal peptide, 3 x PF00153; Mitochondrial carrier protein	<b>attribution</b>:
PF13_0358	mitochondrial import inner membrane translocase, putative	protein translocase activity	protein targeting to mitochondrion	mitochondrial intermembrane space	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0357	hypothetical protein, conserved					
PF13_0356	hypothetical protein, conserved					
MAL13P1.345	hypothetical protein, conserved				orthologs identified in P. knowlesi and P. vivax but not in P. chabaudi, P. Berghei	
MAL13P1.344	RNAse L inhibitor protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.343	proteasome regulatory subunit, putative		ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.342	hypothetical protein, conserved			apicoplast	all_bases.cand.99 - score = 69.41, potential signal peptide	
PF13_0355	hypothetical protein, conserved			apicoplast	PF02987 Late embryogenesis abundant protein	
PF13_0354	alanine--tRNA ligase, putative	alanine-tRNA ligase activity	alanyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.341	60S ribosomal protein				60S ribosomal protein	<b>attribution</b>:
PF13_0353	NADH-cytochrome b5 reductase, putative	electron carrier activity	electron transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0352	nucleoside transporter				PfENT1	
MAL13P1.340	hypothetical protein, conserved			membrane	has FK506 binding protein -like domain	hypothetical protein, potential N-terminal transmembrane domain
MAL13P1.339	hypothetical protein, conserved				hypothetical protein, conserved	
MAL13P1.338	u1 small nuclear ribonucleoprotein, putative	RNA binding	RNA processing	snRNP U1	Pfam hit to PF00076 RNA recognition motif	<b>attribution</b>:
MAL13P1.337	Skp1 family protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.336	hypothetical protein, conserved					
MAL13P1.335	phosphatidylserine synthase i; putative	phosphotransferase activity, for other substituted phosphate groups	phosphatidylserine biosynthetic process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0351	hypothetical protein				hypothetical protein	
PF13_0350	signal recognition particle receptor alpha subunit, putative	GTP binding, signal recognition particle binding		signal recognition particle receptor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0349	nucleoside diphosphate kinase b; putative	ATP binding, nucleoside diphosphate kinase activity	CTP biosynthetic process, GTP biosynthetic process, UTP biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0348	PfRhop148,Rhoptry protein				PfRhop148	<b>attribution</b>:
MAL13P1.334	hypothetical protein, conserved					
MAL13P1.333	hypothetical protein, conserved					
MAL13P1.332	hypothetical protein, conserved			apicoplast	2 potential transmembrane domains	
MAL13P1.331	hypothetical protein, conserved				conserved hypothetical protein	
PF13_0347	hypothetical protein, conserved					
PF13_0346	ubiquitin/ribosomal fusion protein uba52 homologue, putative	protein tag, structural constituent of ribosome	protein modification, translation, ubiquitin-dependent protein catabolic process	ribosome	fused ubiquitin-ribosomal protein, PF00240 Ubiquitin family, PF01020 Ribosomal L40e family	<b>attribution</b>:
MAL13P1.330	hypothetical protein, conserved					
MAL13P1.329	hypothetical protein, conserved			membrane	partially conserved hypothetical protein, contains 6 potential transmembrane domains	
MAL13P1.328	hypothetical protein, conserved	catalytic activity			PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase, family	
PF13_0345	aminomethyltransferase, mitochondrial precursor	aminomethyltransferase activity	glycine catabolic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0344	UBA/THIF-type NAD/FAD binding protein, putative	catalytic activity		apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0343	hypothetical protein, conserved					
MAL13P1.580	hypothetical protein, conserved				annotation change, aeb, 21-04-05, new gene model defined after TBLASTX comparison with P. knowlesi	
MAL13P1.327	Ribosomal protein S17 homologue, putative		translation	organellar small ribosomal subunit, ribosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0342	hypothetical protein, conserved					
MAL13P1.326	ferrochelatase, putative	ferrochelatase activity, ferrous iron binding	heme biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0341	DNA-directed RNA polymerase 2, putative	DNA binding, DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	RNA polymerase Rpb5, C-terminal domain, putative	<b>attribution</b>:
MAL13P1.325	hypothetical protein, conserved				hypothetical protein	
MAL13P1.324	aldo-keto reductase, putative	aldo-keto reductase activity	metabolic process	apicoplast	PF00248 Aldo/keto reductase family	<b>attribution</b>:
PF13_0340	exosome complex exonuclease, putative	3'-5'-exoribonuclease activity	RNA processing	exosome (RNase complex)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.323	hypothetical protein, conserved				potential transmembrane	
MAL13P1.322	splicing factor, putative	ATP-dependent RNA helicase activity, RNA splicing factor activity, transesterification mechanism	nuclear mRNA splicing, via spliceosome		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0339	hypothetical protein, conserved					
PF13_0338	cysteine-rich surface protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.321	hypothetical protein, conserved					
MAL13P1.320	hypothetical protein, conserved				all_bases.cand.73 hypothetical protein, potential signal peptide and transmembrane regions	
MAL13P1.319	hypothetical protein, conserved				all_bases.cand.71 - score = 109.28, potential signal sequence, PF00218 Indole-3-glycerol phosphate synthase	
PF13_0337	hypothetical protein, conserved					
PF13_0336	hypothetical protein, conserved					
PF13_0335	hypothetical protein, conserved				PF00400 WD domain, G-beta repeat	
MAL13P1.318	hypothetical protein, conserved					
PF13_0334	polynucleotide kinase, putative	damaged DNA binding	response to DNA damage stimulus		some similarity to polynucleotide kinase 3' phosphatase	
PF13_0333	hypothetical protein, conserved					
MAL13P1.317	hypothetical protein, conserved					
MAL13P1.316	hypothetical protein, conserved					
MAL13P1.315	hypothetical protein, conserved					
MAL13P1.314	hypothetical protein, conserved					
MAL13P1.313	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly resulting in 18 amino acids being added to the predicted protein sequence. Note that the prediction of introns in this gene model is made very difficult to the highly repetetive nature of the sequence	
MAL13P1.312	hypothetical protein, conserved					
MAL13P1.311	exonnuclease, putative				all_bases.cand.59 - score = 56.19, PF01612 3'-5' exonuclease	
MAL13P1.310	cysteine protease, calpain family				annotation change, aeb, 170105, gene model modified on reampping onto new sequence assembly.18 amino acids added to the N-termins of the predicted protein sequence which is now MGCINSKVKEKRKIKKRKKEECNLI.. was formerly MGKNVIKE..	<b>attribution</b>:
PF13_0331	hypothetical protein, conserved				Potential signal peptide and transmembrane domain present	
PF13_0330	ATP-dependent DNA helicase, putative	ATP-dependent DNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.309	14-3-3 protein, putative				all_bases.C.cand.45 - score = 25.67, PF00244 14-3-3 protein	<b>attribution</b>:
PF13_0329	hypothetical protein				all_bases.cand.56 - score = 20.27, hypothetical protein, potential transmembrane domain	
PF13_0328	proliferating cell nuclear antigen				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.308	hypothetical protein, conserved				all_bases.cand.54 - score = 304.83, SM0185 Armadillo/beta-catenin-like repeats	
PF13_0327	cytochrome c oxidase subunit 2, putative				potential transmembrane domain	
MAL13P1.307	hypothetical protein, conserved				some similarity to small hypotheticals	
MAL13P1.306	hypothetical protein, conserved				all_bases.C.cand.50 - score = 30.87, PF00169 PH domain	
PF13_0326	actin-depolymerizing factor, putative		actin filament depolymerization, actin polymerization and/or depolymerization	cytoskeleton	PF00241 Cofilin/tropomyosin-type actin-binding protein	<b>attribution</b>:
MAL13P1.305	hypothetical protein, conserved				4 potential transmembrane domains	
MAL13P1.304	malaria antigen	molecular_function	biological_process	cellular_component		
PF13_0324	Sec24 subunit, putative	protein transporter activity	ER to Golgi vesicle-mediated transport	COPII vesicle coat	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0323	binding protein, putative	protein binding				
MAL13P1.303	polyadenylate binding protein, putative	poly(A) binding	RNA processing		three PF00076 RNA recognition motifs	<b>attribution</b>:
PF13_0322	falcilysin	metalloendopeptidase activity	hemoglobin metabolic process	food vacuole	flN	<b>attribution</b>:
MAL13P1.302	SUMO ligase, putative				all_bases.C.cand.55 - score = 61.97, PF02037 SAP domain, PF00628 PHD-finger, PF02891 MIZ zinc finger, some low level similarities	<b>attribution</b>:
PF13_0321	hypothetical protein				probably spliced upstream	
MAL13P1.301	protein with aminophospholipid-transporting P-ATPase and guanyl cyclase domains				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0319	hypothetical protein, conserved					
MAL13P1.300	hypothetical protein, conserved			apicoplast	three potential transmembrane domains	
MAL13P1.299	hypothetical protein, conserved				Contians three putative transmembrane domains	
PF13_0318	RNA-binding protein, putative				Pfam hit to PF00076 RNA recognition motif	
PF13_0317	hypothetical protein, conserved				potential transmembrane domain	
MAL13P1.298	hypothetical protein, conserved				4 potential transmembrane domains	
MAL13P1.297	ADP-ribosylation factor, putative	GTPase activity	protein amino acid ADP-ribosylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.296	hypothetical protein, conserved				first exon doesn't start with a start codon	last exon doesn't end with a stop codon
MAL13P1.295	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly resulting in 25 amino acids being removed from the predicted protein sequence	ortholog detected in P. knowlesi and P. vivax, but not in P. berghei and P. chabaudi
MAL13P1.410	hypothetical protein, conserved				annotation change, aeb, (200804) new sequence data 150704, new gene model	
PF13_0315	RNA binding protein, putative	RNA binding				
MAL13P1.289	mitotic control protein dis3 homologue, putative	RNA binding, exonuclease activity		exosome (RNase complex)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.290	high mobility group protein 4, putative	single-stranded DNA binding	DNA unwinding during replication, regulation of transcription, DNA-dependent	chromatin		
MAL13P1.291	hypothetical protein, conserved					
MAL13P1.292	riboflavin kinase / FAD synthase family protein, putative	riboflavin kinase activity	riboflavin biosynthetic process		Possible bi-functional enzyme	<b>attribution</b>:
MAL13P1.293	hypothetical protein, conserved					
MAL13P1.294	GTP-binding protein, putative	GTP binding	signal transduction			
PF13_0316	40S ribosomal protein S13	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.288	hypothetical protein, conserved				Pfam match to PF03134 TB2/DP1, HVA22 family	
PF13_0314	hypothetical protein, conserved				all_bases.cand.40 - score = 136.89, three PF00642 Zinc finger C-x8-C-x5-C-x3-H type (and similar)	
PF13_0313	zinc finger protein	zinc ion binding			two PF03367 ZPR1 zinc-finger domains	
MAL13P1.287	hypothetical protein, conserved				potential transmembrane domains	ortholog detected only in P. knowlesi
PF13_0312	peptidase, putative			apicoplast	ortholog detected only in P. knowlesi and P. vivax	all_bases.C.cand.64 - score = 15.19, PF01694 Rhomboid family, potential N-terminal transmembrane region
MAL13P1.286	hypothetical protein, conserved				hypothetical protein	annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly resulting in addition of 33 amino acids to the predicted amino acid sequence. Previously two introns were defined in what is now a single intron
PF13_0310	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.285	Patatin-like phospholipase, putative			apicoplast	all_bases.C.cand.66 - score = 207.41, PF01734 Patatin-like phospholipase, potential N-terminal transmembrane domain	
MAL13P1.284	pyrroline carboxylate reductase	pyrroline-5-carboxylate reductase activity	proline biosynthetic process		identical to fragment, PF01089 Delta 1-pyrroline-5-carboxylate reductase	<b>attribution</b>:
MAL13P1.283	TCP-1/cpn60 chaperonin family, putative	ATPase activity, coupled, unfolded protein binding	protein folding	chaperonin-containing T-complex	PF00118, TCP-1/cpn60 chaperonin family	
PF13_0309	hypothetical protein, conserved				PF00400 WD domain, G-beta repeats	
MAL13P1.282	hypothetical protein, conserved					
PF13_0308	DNA helicase	DNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0307	hypothetical protein, conserved				hypothetical protein	
PF13_0306	dynein light chain	microtubule motor activity	microtubule-based process	microtubule associated complex	PF01221 Dynein light chain type 1	<b>attribution</b>:
MAL13P1.281	glutamate--tRNA ligase, putative	glutamate-tRNA ligase activity	glutamyl-tRNA aminoacylation	apicoplast	PF00749 tRNA synthetases class I (E and Q), catalytic domain, N-terminal transmembrane domain	<b>attribution</b>:
PF13_0305	elongation factor 1 alpha	translation elongation factor activity	translational elongation	eukaryotic translation elongation factor 1 complex	PF00009 Elongation factor Tu GTP binding domain, PF03144 Elongation factor Tu domain 2, PF03143 Elongation factor Tu C-terminal domain	<b>attribution</b>:
PF13_0304	elongation factor 1 alpha	translation elongation factor activity	translational elongation	eukaryotic translation elongation factor 1 complex	PF00009 Elongation factor Tu GTP binding domain, PF03144 Elongation factor Tu domain 2, PF03143 Elongation factor Tu C-terminal domain	<b>attribution</b>:
MAL13P1.279	P. falciparum Protein Kinase 5	cyclin-dependent protein kinase activity	cell cycle, protein amino acid phosphorylation		PF00069 Protein kinase domain	PfPK5
MAL13P1.278	Ser/Thr protein kinase	protein serine/threonine kinase activity	protein amino acid phosphorylation	cAMP-dependent protein kinase complex	SM0220 S_TKc Serine/Threonine protein kinases, catalytic domain	<b>attribution</b>:
MAL13P1.277	DnaJ-like protein, putative	unfolded protein binding	protein folding		Pfam hit to PF00226 DnaJ domain, potential transmembrane domain	
PF13_0303	regulator of chromosome condensation, putative				hypothetical protein, some low level similarities	
MAL13P1.276	hypothetical protein, conserved			membrane	hypothetical protein, potential transmembrane domains	
PF13_0302	hypothetical protein, conserved	protein phosphatase type 2A regulator activity	protein amino acid dephosphorylation			
PF13_0301	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin-dependent protein catabolic process		PF00179 Ubiquitin-conjugating enzyme, PF00627 UBA/TS-N domain	
PF13_0300	mitochondrial inner membrane translocase, putative	protein transporter activity	protein targeting to mitochondrion	mitochondrial inner membrane presequence translocase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0299	hypothetical protein, conserved					
PF13_0298	hypothetical protein, conserved				ortholog detected in P. knowlesi and P.vivax only (not in P. berghei or P. chabaudi)	
PF13_0297	hypothetical protein, conserved					
PF13_0296	hypothetical protein, conserved					
MAL13P1.275	NLI interacting factor-like phosphatase, putative					
PF13_0295	hypothetical protein, conserved			apicoplast	ortholog detected in P. knowlesi and P.berghei, but not in P.berghei or P. chabaudi	
MAL13P1.274	serine/threonine protein phosphatase pfPp5	protein serine/threonine phosphatase activity	protein amino acid dephosphorylation	protein serine/threonine phosphatase complex	pfpp5	three PF00515 TPR Domains,PF00149 Calcineurin-like phosphoesterase
MAL13_tRNA_Thr1	tRNA threonine				anticodon=GCT; cove score =78.10	annotation change, aeb, (220804) new sequence data 150704, new gene model
PF13_0293	hypothetical protein, conserved				PF01753 MYND finger, PF00856 SET domain	
PF13_0292	hypothetical protein				hypothetical protein, conserved	
PF13_0291	replication licensing factor, putative	DNA binding, DNA-dependent ATPase activity	DNA replication initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.273	hypothetical protein					
PF13_0290	hypothetical protein, conserved					
PF13_0289	protease, caspase family				N-terminal PF00168 C2 domain	<b>attribution</b>:
PF13_0288	hypothetical protein, conserved					
MAL13P1.272	hypothetical protein, conserved				slight similarity to ribosomal proteins	annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly resulting in change to two amino acids
PF13_0287	adenylosuccinate synthetase	GTP binding, adenylosuccinate synthase activity	AMP biosynthetic process, purine nucleotide biosynthetic process		identical to adsS fragment, PF00709 Adenylosuccinate synthetase	<b>attribution</b>:
MAL13P1.271	V-type ATPase, putative			hydrogen-translocating V-type ATPase complex	PF00137 ATP synthase subunit C, signal peptide, transmembrane domains	<b>attribution</b>:
PF13_0286	methyltransferase, putative	RNA methyltransferase activity	rRNA processing		PF01728 FtsJ-like methyltransferase	<b>attribution</b>:
PF13_0285	inositol-polyphosphate 5-phosphatase			membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0284	hypothetical protein, conserved					
PF13_0283	hypothetical protein, conserved				hypothetical protein, PF03179 Vacuolar (H+)-ATPase G subunit1	
MAL13P1.270	proteasome subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	Pfam hit to PF00227 Proteasome A-type and B-type	<b>attribution</b>:
PF13_0282	proteasome subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0281	hypothetical protein, conserved				hypothetical protein, potential transmembrane domains	
PF13_0280	ER lumen protein retaining receptor	KDEL sequence binding, receptor activity		endoplasmic reticulum	erd2, PF00810 ER lumen protein retaining receptor	ERD2
PF13_0279	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0278	Ran-binding protein, putative				hypothetical protein, PF00641 Zn-finger in Ran binding protein and others, PF00076 RNA recognition motif.	
PF13_0277	hypothetical protein, conserved			apicoplast	hypothetical protein, potential N-terminal transmembrane domains	
PF13_0276	membrane-associated histidine rich protein 2, (MARHP2)				predicted transmembrame domain TMHMM at end of exon 1, codon 71-93. Histidine-rich N terminal domain (PS:PS50316)	fragment matches indicate transcribed in ring stage parasites
PF13_0275	hypothetical  protein				hypothetical protein, 2 potential transmembrane domains	
MAL13P1.269	hypothetical protein				orthologs detected in P. knowlesi and P. vivax, but not in P. berghei and P. chabaudi	hypothetical protein, conserved
MAL13P1.268	hypothetical protein				orthologs detected in P. vivax and P. knowlesi, but not in P berghei and P chabaudi	hypothetical protein, conserved
PF13_0274	hypothetical protein, conserved				conserved hypothetical protein, Pfam hit to PF03164 SAND family protein	
PF13_0273	hypothetical protein, conserved					
MAL13P1.267	hypothetical protein, conserved				orthologs detected in P. knowlesi and P. vivax, but not in P. berghei and P. chabaudi	last exon doesn't end with a stop codon
PF13_0272	thioredoxin-related protein, putative	protein disulfide isomerase activity	protein thiol-disulfide exchange		Contains putative signal peptide and transmembrane domain, Pfam hit to PF00085 Thioredoxin	<b>attribution</b>:
MAL13P1.266	hypothetical protein, conserved					
MAL13P1.265	hypothetical protein, conserved					
MAL13P1.264	hypothetical protein, conserved					
PF13_0271	ABC transporter, (heavy metal transporter family)	ATP binding, ATPase activity, coupled to transmembrane movement of substances	transport	apicoplast, membrane	Pfam hit to PF00664 ABC transporter transmembrane region, PF00005 ABC transporter	<b>attribution</b>:
MAL13P1.262	hypothetical protein, conserved			apicoplast		
MAL13P1.261	hypothetical protein, conserved					
PF13_0270	hypothetical protein, conserved					
MAL13P1.260	hypothetical protein, conserved					
PF13_0269	glycerol kinase, putative	ATP binding, glycerol kinase activity	glycerol metabolic process		Pfam hit to PF00370 FGGY family of carbohydrate kinases, N-terminal domain, PF02782 FGGY family of carbohydrate kinases, C-terminal domain	<b>attribution</b>:
PF13_0268	ribosomal protein L17, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.259	hypothetical protein, conserved					
MAL13P1.258	hypothetical protein, conserved			apicoplast		
MAL13P1.257	hypothetical protein, conserved					
MAL13P1.256	phosphatidylinositol transfer protein, putative	phospholipid transporter activity	transport	cytoplasm	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0267	hypothetical protein, conserved					
PF13_0266	hypothetical protein, conserved					
MAL13P1.255	hypothetical protein, conserved			apicoplast	annotation change, aeb, 170105, gene model modified in remapping onto new sequence assembly resulting in the addition of 35 amino acids to the predicted protein sequence, DSDHNNENINKKDSDHNNDTINKKYSDHNNDSINKK	
MAL13P1.254	hypothetical protein, conserved			apicoplast		
PF13_0265	hypothetical protein, conserved			apicoplast		
PF13_0264	hypothetical protein, conserved					
PF13_0263	hypothetical protein, conserved					
MAL13P1.253	small nuclear ribonucleoprotein, putative	RNA splicing factor activity, transesterification mechanism	RNA processing	small nucleolar ribonucleoprotein complex	Pfam hit to PF01423 Sm protein	
PF13_0262	lysine--tRNA ligase	ATP binding, lysine-tRNA ligase activity	lysyl-tRNA aminoacylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.252	hypothetical protein, conserved					
MAL13P1.251	hypothetical protein, conserved			apicoplast		
PF13_0261	ATP binding protein, putative	ATP binding			Pfam hit to PF03029; conserved hypothetical ATP binding protein	
PF13_0260	hypothetical protein, conserved					
MAL13P1.250	hypothetical protein, conserved					
MAL13P1.249	hypothetical protein, conserved					
PF13_0259	cytidine and deoxycytidylate deaminase family, putative	hydrolase activity, zinc ion binding			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0258	sexual stage-specific protein kinase	protein kinase activity	protein amino acid phosphorylation		Pfam hit to PF00536 SAM domain (Sterile alpha motif), PF00069 Protein kinase domain	<b>attribution</b>:
PF13_0257	glutamate--tRNA ligase	ATP binding, glutamate-tRNA ligase activity	glutamyl-tRNA aminoacylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.248	nucleoside diphospahte hydrolase	hydrolase activity	nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		Pfam hit to PF00293 NUDIX domain	<b>attribution</b>:
MAL13P1.247	hypothetical protein, conserved					
PF13_0256	hypothetical protein, conserved					
MAL13P1.246	cation-transporting ATPase				PfATPase4	<b>attribution</b>:
MAL13P1.245	hypothetical protein, conserved					
PF13_0255	hypothetical protein, conserved					
MAL13P1.244	TBC domain protein, putative				Pfam match to PF00566 TBC domain	
PF13_0254	hypothetical protein, conserved					
MAL13P1.243	elongation factor Tu, putative	GTP binding, translation elongation factor activity	translational elongation		PF00009 Elongation factor Tu GTP binding domain, PF00679 Elongation factor G C-terminus	
MAL13P1.242	hypothetical protein, conserved					
MAL13P1.241	GTPase, putative	GTP binding, GTPase activity	small GTPase mediated signal transduction		Pfam hit to PF00071 Ras family, contains potential signal sequence	
MAL13P1.240	hypothetical protein, conserved					
MAL13P1.239	hypothetical protein, conserved					
MAL13P1.238	hypothetical protein, conserved				PF00560 Leucine Rich Repeats	
PF13_0253	ethanolamine-phosphate cytidylyltransferase, putative	ethanolamine-phosphate cytidylyltransferase activity	phospholipid biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.237	hypothetical protein, conserved					
MAL13P1.236	hypothetical protein, conserved					
MAL13P1.235	hypothetical protein, conserved					
PF13_0252	nucleoside transporter 1	nucleoside transporter activity	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0251	DNA topoisomerase III, putative	DNA topoisomerase (ATP-hydrolyzing) activity	DNA unwinding during replication		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0250	G-beta repeat protein, putative				several PF00400 WD domain, G-beta repeat	
PF13_0249	hypothetical protein, conserved					
PF13_0248	pf47			membrane	Contains N- and C-terminal transmembrane domains	GPI-Anchor Signal predicted for PF13_0248 by DGPI v2.04 with cleavage site probability 0.172 near 415
PF13_0247	transmission blocking target antigen precursor			membrane	Contains signal sequence and C-terminal transmembrane domain	pfs45-48
PF13_0246	hypothetical protein, conserved					
PF13_0245	hypothetical protein, conserved					
MAL13P1.234	hypothetical protein, conserved					
MAL13P1.233	hypothetical protein, conserved				PF01918 Protein of unknown function DUF78	
MAL13P1.232	mog1 homolog, putative					
MAL13P1.231	Pfsec61				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.230	hypothetical protein, conserved					
MAL13P1.229	hypothetical protein, conserved					
PF13_0243	hypothetical protein, conserved					
PF13_0242	isocitrate dehydrogenase (NADP), mitochondrial precursor	isocitrate dehydrogenase (NADP+) activity	isocitrate metabolic process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.228	hypothetical protein, conserved					
MAL13P1.227	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	protein modification		Contains putative N-terminal transmembrane domain, Pfam hit to PF00179 Ubiquitin-conjugating enzyme	<b>attribution</b>:
MAL13P1.226	hypothetical protein, conserved					
PF13_0241	peptidase, putative				PF01694 Rhomboid family	
MAL13P1.225	thioredoxin, putative	thiol-disulfide exchange intermediate activity	electron transport		Pfam hit to PF00085 Thioredoxin	<b>attribution</b>:
MAL13P1.224	hypothetical protein, conserved				PF00097 Zinc finger, C3HC4 type (RING finger)	
MAL13P1.223	hypothetical protein					
MAL13P1.222	hypothetical protein, conserved					
MAL13P1.221	aspartate carbamoyltransferase			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0239	hypothetical protein, conserved					
MAL13P1.220	lipoate synthase, putative	lipoic acid synthase activity	lipoic acid biosynthetic process	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.219	hypothetical protein, conserved					
MAL13P1.405	erythrocyte membrane protein pfemp3, putative				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.540	putative hsp protein				annotation change, aeb, (220804) new sequence data 150704, new gene model	
MAL13P1.395	krox-like protein, putative				annotation change, aeb, (220804) new sequence data 150704, new gene model	
MAL13P1.390	hypothetical protein				annotation change, aeb, (220804) new sequence data 150704, new gene model	
MAL13P1.385	RNA binding protein, putative				annotation change, aeb, (220804) new sequence data 150704, new gene model	
MAL13P1.380	chloroquine resistance marker protein, putative				annotation change, aeb, (210804) new sequence data 150704, new gene model	
PF13_0238	conserved protein, putative				Pfam hit to PF02214 K+ channel tetramerisation domain, 7X PF01344 Kelch motifs	
MAL13P1.218	UDP-N-acetylglucosamine pyrophosphorylase, putative	UDP-N-acetylglucosamine diphosphorylase activity	UDP-N-acetylglucosamine metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.217	hypothetical protein, conserved			apicoplast		
MAL13P1.216	DNA helicase, putative	DNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0237	hypothetical protein, conserved					
PF13_0236	hypothetical protein, conserved	molecular_function			PF01170 Putative RNA methylase family UPF0020	
MAL13P1.215	hypothetical protein, conserved					
MAL13P1.214	phosphoethanolamine N-methyltransferase, putative	phosphoethanolamine N-methyltransferase activity	phosphatidylcholine biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0235	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on reampping onto new sequence assembly resulting in the loss of 10 amino acids from the predicted protein sequence,	
PF13_0234	phosphoenolpyruvate carboxykinase	phosphoenolpyruvate carboxykinase (ATP) activity	gluconeogenesis		pepcK	<b>attribution</b>:
MAL13P1.213	transcription activator, putative	transcription factor activity	transcription		SMART hit to SM0659 RPOLCX RNA polymerase subunit CX	<b>attribution</b>:
PF13_0233	myosin a	ATP binding, actin binding, motor activity		myosin complex, pellicle, plasma membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.212	hypothetical protein, conserved			apicoplast	potential signal peptide	
PF13_0232	Casein kinase II regulatory subunit, putative	protein kinase CK2 regulator activity	protein amino acid phosphorylation	protein kinase CK2 complex	PF01214 Casein kinase II regulatory subunit	<b>attribution</b>:
PF13_0231	hypothetical protein, conserved				PF00515 TPR Domain	
PF13_0230	hypothetical protein, conserved				hypothetical protein, potential transmembrane domains	
PF13_0229	IRP-like protein	aconitate hydratase activity, iron ion binding	regulation of translational initiation by iron, tricarboxylic acid cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0228	40S ribosomal subunit protein S6, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	PF01092 Ribosomal protein S6e	<b>attribution</b>:
PF13_0227	vacuolar ATP synthase subunit D, putative		hydrogen transport	hydrogen ion transporting ATPase V0 domain	PF01813 ATP synthase subunit D	<b>attribution</b>:
PF13_0226	hypothetical protein, conserved					
MAL13P1.211	hypothetical protein, conserved				potential transmembrane domains	
MAL13P1.210	dolichyl-phosphate-mannose-glygolipidalpha-mannosyltransferase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0225	hypothetical protein, conserved					
MAL13P1.209	60S ribosomal subunit porotein L18, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	Pfam hit to PF00828 Eukaryotic ribosomal protein L18	<b>attribution</b>:
PF13_0224	60S ribosomal subunit protein L18, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13_U6_snRNA					aeb, ngm	
MAL13_tRNA_Arg1	tRNA Arginine				anticodon=TCT, cove score=81.06	
MAL13P1.206	Na+ -dependent Pi transporter, sodium-dependent phosphate transporter	inorganic phosphate transporter activity	phosphate transport	integral to plasma membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0223	hypothetical protein, conserved			membrane	Contains potential transmembrane domain	
MAL13P1.205	Rab11b, GTPase	GTP binding			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0222	RNA lariat debranching enzyme, putative	RNA lariat debranching enzyme activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0221	hypothetical protein, conserved					
PF13_0220	hypothetical protein, conserved					
PF13_0219	hypothetical protein, conserved					
MAL13P1.204	exoribonuclease PH, putative	3'-5'-exoribonuclease activity	tRNA processing		putative ribonuclease ph, PF01138 3' exoribonuclease family, domain 1	<b>attribution</b>:
MAL13P1.203	hypothetical protein, conserved				potential signal peptide	
PF13_0218	ABC transporter (MDR family)	ATPase activity, coupled to transmembrane movement of substances	transport	integral to membrane	PF00664 ABC transporter transmembrane region, PF00005 ABC transporter	<b>attribution</b>:
PF13_0217	hypothetical protein, conserved					
MAL13P1.202	hypothetical protein, conserved					
MAL13P1.201	hypothetical protein, conserved				potential transmembrane domains	
MAL13P1.200	hypothetical protein, conserved					
PF13_0216	hypothetical protein, conserved				potential transmembrane domain	
PF13_0215	hypothetical protein, conserved					
MAL13_tRNA_Pro1	tRNA Proline				anticodon TGG, cove score 77.73	
MAL13_tRNA_Met1	tRNA Methionine				anticodon=CAT, cove score= 60.25	
MAL13P1.197	hypothetical protein				hypothetical protein	
MAL13P1.196	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation	apicoplast	PF00069 Protein kinase domain, potential N-terminal transmembrane domain	<b>attribution</b>:
MAL13P1.195	hypothetical protein, conserved				SNAP prediction, on sequence chr13.with.gaps score 4.928	annotation change, aeb, 170105, gene model modified on the basis of a manually reviewed SNAP prediction. The 5' end of exon five has been extended and the N-terminal region modified
MAL13P1.194	hypothetical protein, conserved					
MAL13P1.193	hypothetical protein, conserved			apicoplast		
MAL13P1.192	hypothetical protein, conserved					
MAL13P1.191	hypothetical protein, conserved				conserved hypothetical protein	
PF13_0214	elongation factor 1-gamma, putative	glutathione transferase activity, translation elongation factor activity	translational elongation	eukaryotic translation elongation factor 1 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0213	60S ribosomal subunit protein L6e, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.190	proteasome regulatory component, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	putative proteasome regulatory component, PF01399 PCI domain	<b>attribution</b>:
MAL13P1.189	conserved hypothetical protein				hypothetical transmembrane protein, low similarities to other hypothetical proteins (adjusted 5' exon, Bart)	annotation change, aeb, 170105, gene model modified based on a manualy reviewed SNAP prediction. This resulted in the definition of five additional exons
PF13_0212	hypothetical protein, conserved					
PF13_0211	calcium-dependent protein kinase	calcium- and calmodulin-dependent protein kinase activity, protein serine/threonine kinase activity	protein amino acid phosphorylation		putative calcium-dependent protein kinase, PF00069 Protein kinase domain, 4 x PF00036 EF hand	<b>attribution</b>:
MAL13P1.188	hypothetical protein, conserved				weak hit to PF00169 PH domain, associated with eukaryotic signaling proteins	
MAL13_tRNA_Ser1	tRNA Serine				annotation change, aeb, (200804) new sequence data 150704, new gene model	anticodon=CGA ; cove score = 77.78
PF13_0210	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on remapping onto new sequence assembly resulting in 77 amino acids being aded to the predicted protein sequence	
PF13_0209	hypothetical protein, conserved					
PF13_0208	exonuclease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.186	1-deoxy-D-xylulose 5-phosphate synthase			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.185	Pf protein kinase 6				PfPK6	<b>attribution</b>:
MAL13P1.184	endopeptidase, putative	metalloendopeptidase activity	proteolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0205	tryptophan--tRNA ligase, putative	tryptophan-tRNA ligase activity	tryptophanyl-tRNA aminoacylation	apicoplast	PF00579 tRNA synthetases class I (W and Y)	<b>attribution</b>:
PF13_0204	nuclear movement protein, putative	molecular_function	biological_process	cellular_component	No PFAM hits	
PF13_0203	hypothetical protein					
MAL13P1.183	hypothetical protein, conserved					
MAL13P1.182	hypothetical protein, conserved					
MAL13P1.181	hypothetical protein, conserved				Contains putative transmembrane domains	
MAL13P1.180	hypothetical protein, conserved					
PF13_0202	hypothetical protein, conserved					
MAL13P1.179	hypothetical protein, conserved					
PF13_0201	Thrombospondin-related anonymous protein, TRAP			membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0200	hypothetical protein, conserved					
PF13_0199	hypothetical protein, conserved					
MAL13P1.178	hypothetical protein, conserved					
MAL13P1.177	hypothetical protein, conserved					
PF13_0198	reticulocyte binding protein 2 homolog a		entry into host cell	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.176	Plasmodium falciparum reticulocyte binding protein 2, homolog b	binding	entry into host cell		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0197	Merozoite Surface Protein 7 precursor, MSP7		entry into host cell	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0196	MSP7-like protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.175	msp7-like protein fragment				MSP7,fragment	Similar to MSP7
MAL13P1.174	MSP7-like protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0194	hypothetical protein				potential signal sequence present	
PF13_0193	MSP7-like protein				 potential signal sequence present	
PF13_0192	hypothetical protein, conserved			membrane	Potential transmembrane domains present	
MAL13P1.173	MSP7-like protein				Potential signal sequence present, MSP7-like protein family conserved in P. falciparum	
PF13_0191	hypothetical protein, conserved			apicoplast	Potential signal peptide present	
PF13_0190	hypothetical protein, conserved					
PF13_0189	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0188	hypothetical protein, conserved				Weak Pfam hit to PF00628 PHD-finger	
PF13_0187	hypothetical protein, conserved					
PF13_0186	hypothetical protein, conserved					
PF13_0185	histone h3, putative	DNA binding	chromatin assembly or disassembly	nucleosome	Pfam hit to PF0012 Core histone H2A/H2B/H3/H4	<b>attribution</b>:
PF13_0184	hypothetical protein, conserved			membrane	Contains > 2 PF00400 WD domains, G-beta repeats, contains transmembrane domains	
PF13_0183	hypothetical protein, conserved					
MAL13P1.172	hypothetical protein, conserved				Pfam hit to PF01871 Domain of unknown function DUF51	
MAL13P1.171	transmembrane protein Tmp21 homologue, putative	protein carrier activity	intracellular protein transport	apicoplast, membrane	Putative Tmp21 cargo protein, contains signal sequence, Pfam hit to PF01105 emp24/gp25L/p24 family	<b>attribution</b>:
PF13_0182	hypothetical protein, conserved			apicoplast, membrane	Contains potential transmembrane domains	
PF13_0181	hypothetical protein, conserved				MAL13P3.C.cand.22 - score = 71.94, hypothetical protein	
PF13_0180	chaperonin, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0179	isoleucine--tRNA ligase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0178	translation initiation factor 6, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0177	ATP-dependent RNA helicase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0176	apurinic/apyrimidinic endonuclease Apn1				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0175	hypothetical protein, conserved					
MAL13P1.170	hypothetical protein, conserved					
PF13_0174	P. falciparum homologue of human mbp-1 interacting protein-2a; putative		ER to Golgi vesicle-mediated transport, vesicle-mediated transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0173	hypothetical protein, conserved				MAL13P3.cand.93 - score = 150.23, hypothetical protein	
PF13_0172	hypothetical protein, conserved			apicoplast	hypothetical protein, multiple transmembrane domains	
MAL13P1.169	syntaxin 5, putative				Pfam hit to PF00804 Syntaxin	<b>attribution</b>:
PF13_0171	60S ribosomal protein L23, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0170	glutaminyl-tRNA synthetase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.168	hypothetical protein, conserved					
PF13_0169	hypothetical protein, conserved					
PF13_0168	hypothetical protein, conserved			apicoplast		
MAL13P1.167	signal peptidase, putative	signal peptidase activity	signal peptide processing	signal peptidase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0167	hypothetical protein, conserved				MAL13P3.cand.85 - score = 63.00, hypothetical protein	
MAL13P1.166	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0166	protein kinase, putative				Pfam hit to PF00069 Protein kinase domain	
PF13_0165	hypothetical protein, conserved				hypothetical protein, PF00076 RNA recognition motif, ser asp repeats, similar to fibrinogen binding proteins	
MAL13P1.165	hypothetical protein, conserved					
MAL13P1.164	elongation factor tu, putative	GTP binding, translation elongation factor activity	translational elongation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0164	hypothetical protein, conserved				Weak SMART hit to SM0667 LisH Lissencephaly type-1-like homology motif and SM0668 CTLH C-terminal to LisH motif	
MAL13P1.163	er lumen protein retaining receptor 1, putative	KDEL sequence binding	intracellular protein transport	endoplasmic reticulum	Contains signal sequence, Pfam hit to PF00810 ER lumen protein retaining receptor	
MAL13P1.162	DNAJ-like protein, putative		response to heat, response to unfolded protein		Pfam hit to PF00226 DnaJ domain	
MAL13P1.161	hypothetical protein, conserved			apicoplast	potential N-terminal transmembrane domain	
MAL13P1.160	hypothetical protein, conserved			apicoplast	potential N-terminal transmembrane domain	
MAL13P1.159	hypothetical protein, conserved					
MAL13P1.158	hypothetical protein, conserved					
MAL13P1.157	hypothetical protein, conserved					
MAL13P1.156	hypothetical protein, conserved				potential transmembrane domain	
PF13_0163	hypothetical protein, conserved					
PF13_0162	hypothetical protein, conserved					
MAL13P1.146	AMP deaminase, putative	AMP deaminase activity	AMP catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0149	chromatin assembly factor 1 subunit, putative	chromatin binding, histone binding, unfolded protein binding	chromatin assembly or disassembly	chromatin assembly complex	Also similar to WD40/G-beta repeat protein Msi1 from several plant species; contains a long internal extension when compared to other chromatin assembly factor 1 / wd-40 repeat protein msi1	
MAL13P1.147	hypothetical protein, conserved				hypothetical protein	
MAL13P1.148	P. falciparum myosin	microfilament motor activity, motor activity	actin filament-based movement, cytoskeleton organization and biogenesis	myosin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0150	DNA-directed RNA polymerase 3 largest subunit	DNA-directed RNA polymerase activity	transcription from RNA polymerase III promoter	DNA-directed RNA polymerase III complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0151	hypothetical protein, conserved				hypothetical protein, presence of SM0580 PUG domain	
PF13_0152	transcriptional regulatory protein sir2 homologue, putative	DNA binding	chromatin silencing, regulation of transcription, DNA-dependent	chromatin silencing complex	Pfam hit to PF02146 Sir2 family	
MAL13P1.149	hypothetical protein, conserved					
PF13_0153	hypothetical protein, conserved					
MAL13P1.150	hypothetical protein, conerved			membrane	hypothetical protein, presence of possible transmembrane domain	
PF13_0154	hypothetical protein, conserved			membrane	hypothetical protein, presence of possible transmembrane domains	
PF13_0155	hypothetical protein, conserved					
PF13_0156	proteasome subunit beta type 7 precursor, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.151	hypothetical protein, conserved					
PF13_0157	ribose-phosphate pyrophosphokinase, putative	ribose phosphate diphosphokinase activity	histidine biosynthetic process, nucleoside metabolic process, tryptophan biosynthetic process	apicoplast	Pfam hit to PF00156 Phosphoribosyl transferase domain. Large N-terminal extension present. Phosphoribosyl pyrophosphate synthetase (EC 2.7.6.1) (PRPP synthetase)catalyzes the formation of PRPP from ATP and ribose 5-phosphate. PRPP is then used in various biosynthetic pathways, as for example in the formation of purines, pyrimidines, histidine and tryptophan. PRPP synthetase requires inorganic phosphate and magnesium ions for its stability and activity.	<b>attribution</b>:
PF13_0158	up-frameshift suppressor3, upf3, family putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0159	nucleotidyltransferase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.152	hypothetical protein, conserved					
PF13_0160	hypothetical protein, conserved					
PF13_0161	hypothetical protein, conserved					
MAL13P1.153	hypothetical protein, conserved					
MAL13P1.154	hypothetical protein, conserved					
MAL13P1.155	hypothetical protein, conserved				first exon doesn't start with a start codon	possible transmembrane domain
MAL13P1.370	hypothetical protein, conserved				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.365	conserved hypothetical protein				annotation change, aeb, (200804) new sequence data 150704, new gene model	
MAL13P1.360	hypothetical protein, conserved				annotation change, aeb, (200804) new sequence data 150704, new gene model	
PF13_0148	hypothetical protein, conserved					
MAL13P1.145	hypothetical protein, conserved				potential transmembrane domain	annotation change, aeb, 180105, gene model modified on remapping onto new sequence assembly resulting in a change of 2 amino acids in the predicted protein sequence, LYS2067 formerly ASN2069, and 2069LYS formerly ASN2069
MAL13P1.144	hypothetical protein, conserved					
PF13_0147	hypothetical protein, conserved				two PF00076 RNA recognition motifs	
MAL13P1.550	hypothetical protein, conserved				annotation chnage, aeb, 140405, new gene model defined after TBLASTX comparison with P. knowlesi	
MAL13P1.142	hypothetical protein, conserved					
MAL13P1.141	hypothetical protein, conserved				potential transmembrane domain	
MAL13P1.140	hypothetical protein, conserved					
PF13_0146	hypothetical protein, conserved					
MAL13P1.139	hypothetical protein, conserved				Pfam hit to PF00515 TPR Domain, transmembrane domain	
MAL13P1.138	hypothetical protein, conserved					
MAL13P1.137	hypothetical malaria antigen				m26-32-10	Matches to fragment of P.falciparum malaria antigen (M26-32-10) gene ((SWALL:Q25911 (EMBL:M63275))
PF13_0144	oxidoreductase, putative	L-lactate dehydrogenase activity	lactate metabolic process, pyruvate metabolic process		Pfam hit to PF02866 lactate/malate dehydrogenase, alpha/beta C-terminal domain; it is certainly either function as a L-lactate dehydrogenase homologue or malate dehydrogenase homologue; but final product call requires further verification / experimental proof; another P. falciparum L-lactate dehydrogenase (SWALL:LDH1_PLAFD (SWALL:Q27743)) has been identified and expressed in E. coli (PMID:8515777); Its crystal structure is reported in PMID:8901865	<b>attribution</b>:
PF13_0143	phosphoribosylpyrophosphate synthetase	ribose phosphate diphosphokinase activity	pentose-phosphate shunt, purine ribonucleoside salvage		Pfam match to PF00156 Phosphoribosyl transferase domain; in TrEMBL entry this protein starts at the next methionine codon	<b>attribution</b>:
PF13_0142	u6 snRNA-associated sm-like protein, putative	RNA splicing factor activity, transesterification mechanism		spliceosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0141	L-lactate dehydrogenase	L-lactate dehydrogenase activity	anaerobic glycolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0140	dihydrofolate synthase/folylpolyglutamate synthase	ATP binding, dihydrofolate synthase activity, tetrahydrofolylpolyglutamate synthase activity	folic acid and derivative biosynthetic process		Bi-functional enzyme; folylpolyglutamate synthase (EC 6.3.2.17) is the enzyme of folate metabolism that catalyzes ATP-dependent addition of glutamate moieties to tetrahydrofolate. Its sequence is moderately conserved between prokaryotes (gene folC) and eukaryotes.	<b>attribution</b>:
MAL13P1.135	snare protein homologue, putative	SNAP receptor activity	intracellular protein transport	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0139	hypothetical protein, conserved			membrane	Putative transmembrane domains present	
MAL13P1.134	helicase, putative	helicase activity		membrane	SMART hits to DEAD box helicase and Heicase-C terminal domain but no Pfam hit	
PF13_0138	hypothetical protein, conserved					
MAL13P1.133	hypothetical protein, conserved			membrane	Putative transmembrane domains present; Partial; N-terminal missing because contig ends	
MAL13P1.132	microfibril-associated protein homologue, putative	extracellular matrix structural constituent		extracellular matrix (sensu the Metazoa research community)		
MAL13P1.131	hypothetical protein, conserved			apicoplast, membrane	possible transmembrane domains present	
PF13_0137	hypothetical protein, conserved				hypothetical protein	
PF13_0136	hypothetical protein, conserved					
PF13_0135	hypothetical protein, conserved					
MAL13P1.130	hypothetical protein, conserved			membrane	possible signal peptide and transmembrane domains present	
PF13_0134	hypothetical protein, conserved			apicoplast, membrane	Weak SMART hit to SM0464 LON domain, contains putative transmembrane domain; shows weak homology to liver stage-specific antigen 1 but the sequence homology is not strong enough for a prooduct call as a Plasmodium falciparum liver stage-specific antigen 1-like protein	
PF13_0133	aspartyl (acid) protease, putative	aspartic-type endopeptidase activity	proteolysis	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0132	60S ribosomal protein L23a, putative	rRNA binding, structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	Pfam hit to PF00276 Ribosomal protein L23	<b>attribution</b>:
PF13_0131	hypothetical protein, conserved				Weal Pfam hit to PF00583 Acetyltransferase (GNAT) family	
PF13_0130	vacuolar ATP synthase subunit g, putative		vacuolar acidification	hydrogen ion transporting ATPase V1 domain	Similar to several Vacuolar (H+)-ATPase G subunits	<b>attribution</b>:
PF13_0129	ribosomal protein L6 homologue, putative	RNA binding, structural constituent of ribosome	translation	large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0128	beta-hydroxyacyl-acp dehydratase precursor	(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase activity, catalytic activity	fatty acid biosynthetic process	apicoplast	Pfam hit to PF01377 Thioester dehydrase	<b>attribution</b>:
MAL13P1.129	hypothetical protein, conserved			membrane	hypothetical protein, contains potential transmembrane domain	
MAL13P1.128	hypothetical protein, conserved					
MAL13P1.127	hypothetical protein, conserved					
PF13_0127	hypothetical protein, conserved					
MAL13P1.126	hypothetical protein, conserved	zinc ion binding		membrane	Contains PF01529 DHHC zinc finger domain, PF00023 Ankyrin repeat, transmembrane domains	
MAL13P1.125	hypothetical protein, conserved					
PF13_0126	hypothetical protein, conserved					
MAL13P1.124	hypothetical protein, conserved					
MAL13P1.123	hypothetical protein, conserved					
MAL13P1.122	hypothetical protein, conserved				Contains Pfam PF00856 SET domain	
MAL13P1.121	hypothetical protein, conserved			membrane	transmembrane domain present, Pfam hit to PF01150 GDA1/CD39 (nucleoside phosphatase) family	
PF13_0125	hypothetical protein, conserved			apicoplast	potential signal peptide present	
PF13_0124	hypothetical protein, conserved			membrane	hypothetical protein, contains four potential transmembrane domains	
MAL13P1.120	splicing factor, putative	RNA splicing factor activity, transesterification mechanism, mRNA binding	RNA splicing		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.119	cAMP-specific 3',5'-cyclic phosphodiesterase 4B, putative	calmodulin-dependent cyclic-nucleotide phosphodiesterase activity	signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.118	cAMP-specific 3',5'-cyclic phosphodiesterase 4D, putative	calmodulin-dependent cyclic-nucleotide phosphodiesterase activity	signal transduction		Pfam hit to PF00233 3'5'-cyclic nucleotide phosphodiesterase, transmembrane domains	<b>attribution</b>:
MAL13P1.117	hypothetical protein, conserved	zinc ion binding			Pfam hit to PF01529 DHHC zinc finger domain, transmembrane domains	
MAL13P1.116	hypothetical protein, conserved				hypothetical protein, transmembrane domains	first exon doesn't start with a start codon
MAL13P1.115	hypothetical protein, conserved					
MAL13P1.114	hypothetical protein, conserved			apicoplast, membrane	hypothetical protein, possible N-terminal transmembrane domain	
PF13_0123	hypothetical protein, conserved					
PF13_0122	cyclophilin, putative	RNA binding, peptidyl-prolyl cis-trans isomerase activity	protein folding		PF00076 RNA recognition motif	
PF13_0121	dihydrolipoamide succinyltransferase, putative	dihydrolipoyllysine-residue succinyltransferase activity	2-oxoglutarate metabolic process	mitochondrion	Hit to PF00364 Biotin-requiring enzyme, PF00198 2-oxo acid dehydrogenases acyltransferase (catalytic domain)	<b>attribution</b>:
PF13_0120	dihydrolipoamide suucinyl transferase, putative					
PF13_0119	Rab11a, GTPase	GTP binding, GTPase activity	protein transport, small GTPase mediated signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.113	synaptosomal-associated protein of 25 kDa, (SNAP 25), putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0118	microsomal signal peptidase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.112	hypothetical protein,conserved				MAL13P3.C.cand.77 - score = 60.46, hypothetical protein	
PF13_0117	hypothetical protein, conserved				PF00566 TBC domain	
MAL13P1.111	hypothetical protein, conserved					
PF13_0116	hypothetical protein, conserved					
MAL13P1.107	hypothetical protein, conserved				GPI-Anchor Signal predicted for MAL13P1.107 by DGPI v2.04, no cleavage site predicted	hypothetical protein, possible signal sequence present
MAL13P1.106	hypothetical protein			membrane	Possible transmembrane domain present	
MAL13P1.105	hypothetical protein, conserved				Pfam hit to PF02985 HEAT repeat	
PF13_0114	hypothetical protein, conserved					
PF13_0112	hypothetical protein, conserved					
MAL13P1.103	hypothetical protein, conserved					
PF13_0109	N2,N2-dimethylguanosine tRNA methyltransferase, putative	tRNA (guanine-N2-)-methyltransferase activity	tRNA modification	apicoplast	Possible PF02005 N2,N2-dimethylguanosine tRNA methyltransferase	<b>attribution</b>:
PF13_0107	hypothetical protein, conserved				hypothetical protein	
PF13_0106	hypothetical protein, conserved					
PF13_0104	hypothetical protein, conserved				Possible transmembrane domain	
PF13_0103	hypothetical protein, conserved					
PF13_0102	DNAJ-like Sec63 homologue	unfolded protein binding	protein folding, protein targeting to ER	integral to endoplasmic reticulum membrane, translocon complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.102	hypothetical protein, conserved					
MAL13P1.100	hypothetical protein, conserved				hypothetical protein	
MAL13P1.97	hypothetical protein				hypothetical protein	
MAL13P1.96	chromosome segregation protein, putative		mitotic sister chromatid segregation		Pfam hit to PF02463, RecF/RecN/SMC N terminal domain, Pfam hit to PF02483 SMC family, C-terminal domain	
PF13_0101	hypothetical protein, conserved					
PF13_0100	glycerol-3-phosphate acyltransferase, putative	glycerol-3-phosphate O-acyltransferase activity	glycerolipid biosynthetic process	apicoplast	Possible glycerol-3-p acyltransferase, no Pfam hit	<b>attribution</b>:
MAL13P1.95	ferredoxin	electron carrier activity	electron transport	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.94	hypothetical protein, conserved				Contains possible 4 transmembrane domains	
MAL13P1.93	hypothetical protein, conserved					
MAL13P1.92	40S ribosomal protein S15, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Alternative exonI possible, Pfam hit to PF00203 Ribosomal protein S19	<b>attribution</b>:
MAL13P1.91	hypothetical protein, conserved					
MAL13P1.90	hypothetical protein, conserved					
MAL13P1.89	hypothetical protein, conserved				Possible signal peptide present	
PF13_0099	hypothetical protein, conserved				hypothetical protein, contains match to Zinc finger domain in Ran- binding proteins	
PF13_0098	hypothetical protein, conserved					
PF13_0097	hypothetical protein, conserved					
PF13_0095	DNA replication licensing factor mcm4-related		DNA replication initiation, DNA unwinding during replication		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0096	Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger protein	ubiquitin thiolesterase activity	ubiquitin-dependent protein catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.88	hypothetical protein, conserved				hypothetical protein	
MAL13P1.87	sec20 homolog, putative			apicoplast		
PF13_0093	hypothetical protein, conserved					
MAL13P1.86	cholinephosphate cytidylyltransferase				cholinephosphate cytidylyltransferase, SWALL entry starts at 530 (SWALL:CTPT_PLAFK (SWALL:P49587)); PMID:7588775	<b>attribution</b>:
PF13_0091	hypothetical protein, conserved				2x PF00397 WW domain, 3 x PF01846 FF domain	
MAL13P1.85	hypothetical protein, conserved					
PF13_0090	ADP-ribosylation factor, putative	GTPase activity	intracellular protein transport		Pfam hit to PF00025 ADP- ribosylation factor family	<b>attribution</b>:
PF13_0089	hypothetical protein, conserved					
MAL13P1.84	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.83	karyopherin				low level similarity with exportin, no pfam	<b>attribution</b>:
PF13_0088	Myb1 protein	DNA binding			myb1	Pfam hit to PF00249 Myb-like DNA-binding domain
PF13_0087	hypothetical protein, conserved					
MAL13P1.82	phosphatidylinositol synthase, putative	CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity	phosphatidylinositol biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.81	hypothetical protein, conserved					
MAL13P1.80	hypothetical protein, conserved					
MAL13P1.79	hypothetical protein, conserved					
PF13_0086	hypothetical protein, conserved					
MAL13P1.78	hypothetical protein, conserved				Possible transmembrane domain present	annotation change, aeb, 180105, gene model modified, N-terminus redefined resulting in a loss of 13 amino acids from the predicted protein sequence. M-terminus formerly, MILYNILYYIILYVFIYYYV.., now MCLYIIMY
PF13_0085	serine/threonine protein kinase, putative	protein serine/threonine kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.77	hypothetical protein, conserved				Contains possible transmembrane domains	
MAL13P1.76	TFIIH basal transcription factor subunit			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0084	ubiquitin-like protein, putative		modification-dependent protein catabolic process		Pfam hit to PF00240 Ubiquitin family	
MAL13P1.75	hypothetical protein, conserved			apicoplast		
PF13_0083	lipoate-protein ligase a, putative	lipoate-protein ligase activity	lipid metabolic process, protein modification		Putative lipoate protein ligase, Pfam hit to PF03099 Biotin/lipoate A/B protein ligase family	<b>attribution</b>:
PF13_0082	cop-coated vesicle membrane protein p24 precursor, putative		intracellular protein transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0081	hypothetical protein, conserved					
MAL13P1.74	hypothetical protein, conserved				Pfam entry to PF01661 Appr-1-p processing enzyme family	
PF13_0080	hypothetical protein, conserved					
MAL13P1.73	hypothetical protein, conserved					
MAL13P1.72	hypothetical protein, conserved				hypothetical protein, contains possible transmembrane domain	
MAL13P1.71	hypothetical protein, conserved				Contains ankyrin repeats and possible transmembrane domain	annotation change, aeb, 170105, gene model modified on remapping resulting in addition of 193 amino acids ot the predicted protein sequence
MAL13P1.70	hypothetical protein, conserved			apicoplast	Contains putative transmembrane domains	
MAL13P1.69	septum formation protein MAF homologue, putative	molecular_function	biological_process	cellular_component	Pfam hit to PF02545 Maf- like protein	
PF13_0079	hypothetical protein, conserved					
PF13_0078	hypothetical protein, conserved				Contains putative multiple transmembrane domains	
PF13_0077	DEAD box helicase, putative	helicase activity		apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.68	peptidyl-prolyl cis-trans isomerase, putative			apicoplast	Pfam hit to PF00254 FKBP-type peptidyl-prolyl cis-trans isomerase	
MAL13P1.67	methionyl-tRNA formyltransferase, putative	methionyl-tRNA formyltransferase activity	translational initiation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.66	hypothetical protein, conserved					
MAL13P1.65	hypothetical protein					
MAL13P1.64	ubiquitin-like protein nedd8 homologue, putative		modification-dependent protein catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.63	Plasmodium falciparum asparagine-rich protein	molecular_function	biological_process	cellular_component		
PF13_0072	hypothetical protein, conserved					
PF13_0071	hypothetical protein					
PF13_0070	branched-chain alpha keto-acid dehydrogenase, putative	alpha-ketoacid dehydrogenase activity		alpha-ketoglutarate dehydrogenase complex (sensu the Eukaryota research community)	Significant Pfam hit to PF00676 dehydrogenase_E1 component	<b>attribution</b>:
PF13_0069	translation initiation factor if-2, putative	translation initiation factor activity	translational initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0068	hypothetical protein, conserved					
MAL13P1.57	hypothetical protein, conserved					
PF13_0067	hypothetical protein, conserved				Contains possible GYF domain	
PF13_0066	malonyl coa-acyl carrier protein transacylase precursor	[acyl-carrier-protein] S-malonyltransferase activity	fatty acid biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0065	vacuolar ATP synthase, catalytic subunit a		ATP hydrolysis coupled proton transport, vacuolar acidification	hydrogen ion transporting ATPase V1 domain	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.56	m1-family aminopeptidase	aminopeptidase activity, metalloendopeptidase activity	proteolysis	apicoplast, cytoplasm	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.55	cytochrome c2 precursor,putative		electron transport	mitochondrial electron transport chain	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0064	hypothetical protein, conserved					
PF13_0063	26S proteasome regulatory subunit 7, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0062	clathrin-adaptor medium chain, putative		intracellular protein transport, vesicle-mediated transport	clathrin adaptor complex, clathrin vesicle coat	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0061	ATP synthase gamma chain, mitochondrial precursor, putative		ATP synthesis coupled proton transport, hydrogen transport	mitochondrion, proton-transporting ATP synthase, catalytic core (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.54	hypothetical protein, conserved					
PF13_0060	hypothetical protein, conserved					
MAL13P1.53	hypothetical protein, conserved					
PF13_0059	ribosomal protein S15, mitochondrial precursor, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.52	hypothetical protein, conserved				Contains putative TPR repeats	
PF13_0058	RNA-binding protein, putative					
MAL13P1.51	Rab5b, GTPase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.50	hypothetical protein, conserved				Contains possible transmembrane domains	
PF13_0056	hypothetical protein, conserved					
PF13_0055	hypothetical protein, conserved	zinc ion binding			Pfam and SMART hits to FYVE zinc finger	
MAL13P1.49	hypothetical protein, conserved			apicoplast	Contains putative transmembrane domains	
MAL13P1.48	hypothetical protein, conserved					
MAL13P1.47	mitochondrial ATP synthase delta subunit, putative		ATP synthesis coupled proton transport, hydrogen transport	mitochondrion, proton-transporting ATP synthase, catalytic core (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.46	hypothetical protein, conserved					
PF13_0054	transcription factor, putative					
PF13_0053	hypothetical protein, conserved					
PF13_0052	ribosomal RNA methyltransferase, putative	RNA methyltransferase activity	rRNA processing		Pfam hit to FtsJ-like methyltransferase	<b>attribution</b>:
PF13_0051	snornp protein gar1 homologue, putative		RNA modification			
PF13_0050	hypothetical protein, conserved					
MAL13P1.45	U4/U6 small nuclear ribonuclear protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.44	protein phosphatase 2c-like protein, putative	protein serine/threonine phosphatase activity	protein amino acid phosphorylation	protein serine/threonine phosphatase complex	Pfam and SMART hit to PP2C domain	
PF13_0049	60S ribosomal protein L24, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	Pfam hit to PF01246 Ribosomal protein L24e	<b>attribution</b>:
MAL13P1.43	hypothetical protein, conserved					
PF13_0048	NUDIX hydrolase, putative					
MAL13P1.42	recombinase, putative					
PF13_0047	hypothetical protein, conserved					
MAL13P1.41	hypothetical protein, conserved				annotation change, aeb, 170105,fused with PF13_0046 in new sequence assembly. Domain organisation also suggests that this is a single gene.	
MAL13P1.40	Proteinase inhibitor protein, putative					
MAL13P1.39	hypothetical protein, conserved					
PF13_0045	40S ribosomal protein S27, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0044	carbamoyl phosphate synthetase, putative	carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity	'de novo' pyrimidine base biosynthetic process, glutamate catabolic process		cpsSII	<b>attribution</b>:
PF13_0043	CCAAT-binding transcription factor, putative	DNA binding, transcription factor activity	regulation of transcription, DNA-dependent		Contains CCAAT box factor domain	
MAL13P1.38	hypothetical protein, conserved					
MAL13P1.37	hypothetical protein, conserved					
PF13_0042	fork head domain protein, putative	protein binding		nucleus		
PF13_0041	hypothetical protein, conserved					
PF13_0040	DNA-directed RNA polymerase alpha chain, putative	DNA-directed RNA polymerase activity		apicoplast	Possible signal sequence present, so could be organellar	<b>attribution</b>:
PF13_0039	hypothetical protein, conserved			apicoplast		
PF13_0038	hypothetical protein, conserved					
PF13_0037	DEAD box helicase, putative	ATP-dependent RNA helicase activity				
PF13_0036	DNAJ protein, putative	molecular_function	biological_process	cellular_component		
PF13_0035	hypothetical protein, conserved					
MAL13P1.36	hypothetical protein, conserved					
MAL13P1.35	u1 small nuclear ribonucleoprotein a, putative		nuclear mRNA splicing, via spliceosome	spliceosome	Similar to several u1 small nuclear ribonucleoprotein a	<b>attribution</b>:
MAL13P1.34	hypothetical protein, conserved					
MAL13P1.33	hypothetical protein, conserved					
PF13_0034	vacuolar ATP synthase subunit h, putative	hydrogen ion transporting ATP synthase activity, rotational mechanism, hydrogen ion transporting ATPase activity, rotational mechanism	vacuolar acidification	hydrogen ion transporting ATPase V1 domain	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.32	hypothetical protein, conserved					
PF13_0033	26S proteasome regulatory subunit, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome regulatory particle (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.31	hypothetical protein, conserved					
PF13_0032	hydrolase, putative			apicoplast		
MAL13P1.30	hypothetical protein					
MAL13P1.29	hypothetical protein, conserved					
PF13_0031	tRNA intron exonumclease, putative					
PF13_0030	hypothetical protein, conserved					
PF13_0029	hypothetical protein, conserved					
PF13_0028	membrane integral peptidase, M50 family, putative					
PF13_0027	hypothetical protein, conserved					
MAL13P1.28	hypothetical protein, conserved					
MAL13P1.26	hypothetical protein, conserved				annotation change, aeb, 200804, new sequence data 150704, fused with MAL13P1.27 in new sequence assembly	MAL13P1.26 was incorporated into this gene model.AEB,041004.
PF13_0026	hypothetical protein					
PF13_0025	hypothetical protein, conserved			apicoplast	Possible transmembrane domain present	
PF13_0024	hypothetical protein, conserved					
PF13_0023	DNA-directed RNA polymerase 2, putative	DNA-directed RNA polymerase activity	transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, holoenzyme	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0022	cyclin 4		regulation of cyclin-dependent protein kinase activity		cyc-4	<b>attribution</b>:
MAL13P1.25	hypothetical protein, conserved			apicoplast		
PF13_0021	small heat shock protein, putative		response to heat, response to unfolded protein			
PF13_0020	hypothetical protein, conserved					
MAL13P1.24	hypothetical protein, conserved					
MAL13P1.23	hypothetical protein, conserved					
MAL13P1.22	DNA ligase 1	DNA ligase (ATP) activity	DNA ligation, lagging strand elongation	apicoplast, replication fork	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL13P1.21	hypothetical protein, conserved					
MAL13P1.20	hypothetical protein, conserved					
MAL13P1.19	peptidase, putative					
MAL13P1.18	hypothetical protein, conserved					
MAL13P1.17	hypothetical protein, conserved					
PF13_0019	sodium/hydrogen exchanger, Na+, H+ antiporter	solute:hydrogen antiporter activity	sodium ion transport	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF13_0018	hypothetical protein, conserved					
PF13_0017	hypothetical protein, conserved					
MAL13P1.16	synaptobrevin-like protein, putative	molecular_function	biological_process	cellular_component	Pfam hit to PF00957 Synaptobrevin	<b>attribution</b>:
PF13_0016	methyl transferase-like protein, putative	N-methyltransferase activity			No pfam hit but similar to putative methyl transferase, not certain about function.	<b>attribution</b>:
MAL13P1.15	hypothetical protein, conserved					
PF13_0015	hypothetical protein, conserved					
PF13_0014	40S ribosomal protein S7 homologue, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Pfam hit to PF01251 Ribosomal protein S7e	<b>attribution</b>:
MAL13P1.14	ATP-dependent DEAD box helicase, putative	ATP-dependent RNA helicase activity			Possible DEAD box helicase	
PF13_0013	PBS lyase HEAT-like repeat domain protein	molecular_function	biological_process	cellular_component	Contains several weak Pfam matches to PF03130 phycobilisome lyase HEAT-like repeat	
MAL13P1.13	hypothetical protein, conserved				hypothetical protein, contains DEXDc3 domain	
MAL13P1.12	hypothetical protein, conserved				Contains putative transmembrane domains	
PF13_0012	early transcribed membrane protein 13, ETRAMP13			apicoplast	ETRAMP 13	
PF13_0011	plasmodium falciparum gamete antigen 27/25	molecular_function	biological_process	cellular_component	pfg27-25	
PF13_0076	hypothetical protein, conserved				Possible transmembrane domain present	
MAL13P1.62	hypothetical protein			apicoplast		
PF13_0075	surface-associated interspersed gene 13.1 (SURFIN13.1)				3D7Surf13.1	Gene model comprised by joining PF13_0074 and previous PF14_0075;Splicing of intron 1 confirmed by RT-PCR evidence kindly presented by Dr Osamu Kaneko;Note that that exon 2 is truncated relative to other members of the Surfin gene family
MAL13P1.61	hypothetical protein, conserved in P. falciparum			apicoplast	Possible transmembrane domain present	
MAL13P1.60	erythrocyte binding antigen 140	molecular_function	biological_process	cellular_component	eba-140	<b>attribution</b>:
MAL13P1.59	hypothetical protein, conserved in P. falciparum			apicoplast		
PF13_0073	hypothetical protein, conserved in P. falciparum					
MAL13P1.58	hypothetical protein, conserved in P. falciparum					
PF13_0010	Gbph2	molecular_function	biological_process	cellular_component	gbph2	Previously reported sequence (SWALL:Q25859 (EMBL:X69769)) has next methione codon as start codon
MAL13P1.11	hypothetical protein, conserved in P. falciparum				Formerly, this region was annotated with two gene models (MAL13P1.11 and MAL13P1.11a). These have been joined to form a single pseudogene. MAL13P1.11 has been retained as the identifier. MAL13P1.11a was the region that is now the terminal 70 aa of MAL13P1.11	
MAL13P1.8	RIF pseudogene				pseudo-RIF	
MAL13P1.7	stevor				Located subtelomerically with a similar two exon structure to the rifins, but comprise a more distinct and conserved gene family; Exon 1 - conserved N-termimus and signal peptide; Exon 2 - Three proposed transmembrane helices flanking a polymorhic region; ; Expression occurs after 22-28 hrs of parasite development, coinciding with mid-trophozoite stage; var, rif, stevor expressed in this relative order; In vitro expression of multiple transcripts is observed, although only a small subset, two or three transcripts per cell, suggesting a transcritional exclusion mechanism. Expression is demonstrated although it is not clear whether multiple transcripts are expressed (PMID:12477793).; Stably associated with Maurer's clefts (MC), membranous structures just below the surface of the membrane are involved in transport of parasite proteins to the membrane (PMID:12477793); Proposed role in protection of MC from immune attack; No evidence that STEVOR is directly exposed on the parasite surface; Evidence of expression of a single STEVOR in sporozoites. (PMID: 12368866); Spliced transcripts observed in gametocytes(PMID:12477793); Review (PMID:14747138)	stevor
MAL13P1.6	erythrocyte membrane protein 1-like				annotation change, aeb, 180105, gene model modified upon remapping onto a new sequence assembly, resulting in a loss of 169 aa from the predicted protein sequence.	VAR-like
MAL13P1.4	rifin				RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF13_0006	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF13_0005	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF13_0004	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
PF13_0003	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	PfEMP-1 is expressed on the surface of infected red blood cells (PMID:14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID:10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID:10677532)(PMID:11915943)(PMID:11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID:11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID:9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID:12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID:12603733) (PMID:7624377)(PMID:11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID:14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID:11872399)
MAL13P1.2	rifin				The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID:3526351)(PMID:7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID:10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID:10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.	RIF
MAL13P1.1	erythrocyte membrane protein 1 (PfEMP1)				VAR	<b>attribution</b>:
PF11_0521	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob, membrane	var;	<b>attribution</b>:
PF11_0520	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0519	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0518	rifin, putative,truncated, pseudogene					
PF11_0517	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0516	stevor, putative	molecular_function	biological_process	Maurer's cleft, membrane		
PF11_0515	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0514	hypothetical protein					
PF11_0513	hypothetical protein				NULL;	
PF11_0512	ring-infected erythrocyte surface antigen 2, RESA-2 - malaria parasite (Plasmodium falciparum)-related	molecular_function	biological_process	membrane	4 frameshifts; RESA;	<b>attribution</b>:
PF11_0511	hypothetical protein				NULL;	
PF11_0510	protein kinase, FIKK family	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0509	ring-infected erythrocyte surface antigen, putative				RESA;	
PF11_0508	hypothetical protein				NULL;	
PF11_0507	antigen 332, putative	molecular_function	biological_process	membrane	NULL;	
PF11_0506	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0505	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0504	hypothetical protein				NULL;	
PF11_0503	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0502	hypothetical protein					
PF11_0501	hypothetical protein					
PF11_0500	hypothetical protein					
PF11_0499	hypothetical protein					
PF11_0498	hypothetical protein					
PF11_0497	hypothetical protein					
PF11_0496	hypothetical protein					
PF11_0495	hypothetical protein					
PF11_0494	hypothetical protein					
PF11_0493	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0492	hypothetical protein					
PF11_0491	hypothetical protein					
PF11_0490	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0489	hypothetical protein				NULL;	
PF11_0488	serine/threonine protein kinase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0487	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0486	MAEBL, putative	binding	biological_process	apical complex, membrane		
PF11_0485	mitochondrial ATP-synthase, delta subunit putative	molecular_function	biological_process	mitochondrion	NULL;	<b>attribution</b>:
PF11_0484	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0483	farnesyltransferase beta subunit, putative	protein farnesyltransferase activity, zinc ion binding	protein amino acid farnesylation	membrane, protein farnesyltransferase complex	NULL;	<b>attribution</b>:
PF11_0482	hypothetical protein				NULL;	
PF11_0481	hypothetical protein				NULL;	
PF11_0480	hypothetical protein				NULL;	
PF11_0479	hypothetical protein				NULL;	
PF11_0478	hypothetical protein				NULL;	
PF11_0477	CCAAT-box DNA binding protein subunit B	DNA binding	regulation of transcription, DNA-dependent	cellular_component	NULL;	<b>attribution</b>:
PF11_0476	leucine-rich repeat protein 10, LRR10				NULL;	
PF11_0475	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0474	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	NULL;	
PF11_0473	hypothetical protein				NULL;	
PF11_0472	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0471	hypothetical protein				NULL;	
PF11_0470	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0469	hypothetical protein				NULL;	
PF11_0468	hypothetical protein				NULL;	
PF11_0467	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0466	transport protein, putative	ATP binding, ATPase activity, coupled to transmembrane movement of substances, transporter activity	transport	apicoplast, integral to membrane, membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0465	dynamin-like protein	GTPase activity	microtubule-based process, vesicle-mediated transport	dynactin complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0464	serine/threonine protein kinase	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0463	coat protein, gamma subunit, putative	molecular_function	vesicle-mediated transport	cytosol	NULL;	<b>attribution</b>:
PF11_0462	hypothetical protein				NULL;	
PF11_0461	PfRab6, GTPase	GTP binding	intracellular protein transport	Golgi apparatus	Rab6	NULL;
PF11_0460	hypothetical protein				NULL;	
PF11_0459	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0458	hypothetical protein				NULL;	
PF11_0457	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0456	hypothetical protein				NULL;	
PF11_0455	hypothetical protein				NULL;	
PF11_0560	hypothetical protein, conserved				annotation change, aeb, 040405, gene model defined after comparison with P. knowlesi	
PF11_0454	Ribosomal protein, 40S subunit, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	NULL;	<b>attribution</b>:
PF11_0453	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0452	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0451	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0450	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0449	hypothetical protein				NULL;	
PF11_0448	hypothetical protein				NULL;	
PF11_0447	translation initiation factor eIF-1A, putative	translation initiation factor activity	translational initiation	eukaryotic 43S preinitiation complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0445	DNA-directed RNA polymerase I, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0443	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	NULL;	
PF11_0442	hypothetical protein				NULL;	
PF11_0441	hypothetical protein				NULL;	<b>attribution</b>:
PF11_0440	hypothetical protein				NULL;	
PF11_0439	hypothetical protein				NULL;	
PF11_0438	Ribosomal protein, putative	structural constituent of ribosome	translation	large ribosomal subunit	NULL;	<b>attribution</b>:
PF11_0437	hypothetical protein				NULL;	
PF11_0436	coproporphyrinogen oxidase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0435	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0434	hypothetical protein				NULL;	
PF11_0433	hypothetical protein				NULL;	
PF11_0432	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0431	membrane skeletal protein, putative	structural constituent of cytoskeleton	biological_process	subpellicular network	NULL;	
PF11_0429	hypothetical protein				NULL;	
PF11_0428	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0427	dolichyl-phosphate b-D-mannosyltransferase, putative	dolichyl-phosphate beta-D-mannosyltransferase activity	protein amino acid glycosylation	endoplasmic reticulum	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0426	hypothetical protein				NULL;	
PF11_0425	hypothetical protein					
PF11_0424	hypothetical protein				NULL;	
PF11_0423	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0422	hypothetical protein				NULL;	
PF11_0421	hypothetical protein				NULL;	
PF11_0420	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0419	hypothetical protein				NULL;	
PF11_0418	hypothetical protein				NULL;	
PF11_0417	hypothetical protein				NULL;	
PF11_0416	myosin heavy chain subunit, putative	actin binding, microfilament motor activity, motor activity	actin filament-based movement, cytoskeleton organization and biogenesis	myosin complex	NULL;	<b>attribution</b>:
PF11_0415	hypothetical protein				NULL;	
PF11_0414	hypothetical protein				NULL;	
PF11_0413	hypothetical protein				NULL;	
PF11_0412	Vacuolar ATP synthase subunit F, putative	hydrogen ion transporting ATPase activity, rotational mechanism	ATP synthesis coupled proton transport, vacuolar acidification	proton-transporting ATP synthase complex (sensu the Eukaryota research community)	NULL;	<b>attribution</b>:
PF11_0411	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0410	hypothetical protein				NULL;	
PF11_0409	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0408	hypothetical protein				NULL;	
PF11_0407	adrenodoxin reductase, putative	NADPH-adrenodoxin reductase activity	electron transport	mitochondrion		
PF11_0406	hypothetical protein				NULL;	
PF11_0405	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0404	malaria antigen				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0403	hypothetical protein				NULL;	
PF11_0402	hypothetical protein				NULL;	
PF11_0401	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0400	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0399	hypothetical protein				NULL;	
PF11_0398	hypothetical protein				NULL;	
PF11_0397	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	NULL;	
PF11_0396	Protein phosphatase 2C	protein phosphatase type 2C activity	protein amino acid dephosphorylation, response to stress	cellular_component	NULL;	
PF11_0395	guanylyl cyclase	guanylate cyclase activity	cGMP biosynthetic process, signal transduction	integral to plasma membrane, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0530	hypothetical protein					
PF11_0394	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0393	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0392	hypothetical protein				NULL;	
PF11_0391	hypothetical protein				NULL;	
PF11_0390	reticulocyte binding protein, putative				NULL;	
PF11_0545	hypothetical protein				annotation change, aeb, 040405, gene model defined after comparison to P. knowlesi	
PF11_0389	hypothetical protein				NULL;	
PF11_0388	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0387	hypothetical protein				NULL;	
PF11_0386	30S ribosomal protein S14, putative	structural constituent of ribosome	translation	apicoplast, small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0385	hypothetical protein				NULL;	
PF11_0384	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	NULL;	
PF11_0383	hypothetical protein				NULL;	
PF11_0382	ribosomal protein S9, putative	structural constituent of ribosome	translation	mitochondrion, small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0381	subtilisin-like protease 2	subtilase activity	proteolysis	dense granule (sensu the Apicomplexa research community), integral to membrane, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0380	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0379	hypothetical protein					
PF11_0378	hypothetical protein				NULL;	
PF11_0377	casein kinase 1, PfCK1	casein kinase I activity	protein amino acid phosphorylation	cellular_component	PfCK1	NULL;
PF11_0375	hypothetical protein				NULL;	
PF11_0374	hypothetical protein				NULL;	
PF11_0373	hypothetical protein				NULL;	<b>attribution</b>:
PF11_0372	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0371	hypothetical protein				NULL;	
PF11_0370	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0369	hypothetical protein				NULL;	
PF11_0368	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0367	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0366	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0365	hypothetical protein				NULL;	
PF11_0364	hypothetical protein				NULL;	
PF11_0363	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0362	protein phosphatase, putative					
PF11_0361	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0360	hypothetical protein				NULL;	
PF11_0359	coatomer delta subunit, putative	molecular_function	retrograde vesicle-mediated transport, Golgi to ER	cytoplasm	NULL;	<b>attribution</b>:
PF11_0358	DNA-directed RNA polymerase, beta subunit, putative	DNA binding, DNA-directed RNA polymerase activity	transcription from RNA polymerase I promoter	DNA-directed RNA polymerase I complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0357	hypothetical protein				NULL;	
PF11_0356	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0355	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0354	hypothetical protein				NULL;	
PF11_0353	hypothetical protein				NULL;	
PF11_0352	protein disulfide isomerase related protein		electron transport, protein folding, protein thiol-disulfide exchange	endoplasmic reticulum lumen	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0351	heat shock protein hsp70 homologue		response to heat, response to unfolded protein	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0350	hypothetical protein				NULL;	
PF11_0349	hypothetical protein				NULL;	
PF11_0348	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0347	hypothetical protein				NULL;	
PF11_0346	hypothetical protein				NULL;	
PF11_0345	hypothetical protein				NULL;	
PF11_0344	apical membrane antigen 1,  AMA1		entry into host cell	apical complex, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0343	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane, mitochondrion	NULL;	
PF11_0342	hypothetical protein				NULL;	
PF11_0341	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0340	hypothetical protein				NULL;	
PF11_0339	hypothetical protein				NULL;	
PF11_0338	Aquaglyceroporin	transporter activity	glycolipid biosynthetic process, transport	integral to plasma membrane, membrane	NULL;	<b>attribution</b>:
PF11_0337	50S ribosomal protein L2, putative	structural constituent of ribosome	translation	apicoplast, mitochondrion, organellar large ribosomal subunit	NULL;	<b>attribution</b>:
PF11_0336	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0335	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0334	amino acid transporter putative	molecular_function	biological_process	membrane	NULL;	<b>attribution</b>:
PF11_0333	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0332	hypothetical protein				NULL;	
PF11_0331	t-complex protein 1, alpha subunit, putative	ATP binding, unfolded protein binding	cytoskeleton organization and biogenesis, protein folding	chaperonin-containing T-complex		
PF11_0330	hypothetical protein				NULL;	
PF11_0329	hypothetical protein				NULL;	
PF11_0328	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0327	hypothetical protein				NULL;	
PF11_0326	hypothetical protein				NULL;	
PF11_0325	hypothetical protein				NULL;	
PF11_0324	hypothetical protein	molecular_function	biological_process	apicoplast, membrane	NULL;	
PF11_0323	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0322	hypothetical protein					
PF11_0321	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0320	hypothetical protein				NULL;	
PF11_0319	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0318	PF16 protein, putative					
PF11_0317	structural maintenance of chromosome protein, putative	AT DNA binding, ATPase activity, double-stranded DNA binding	mitotic sister chromatid segregation	cohesin complex	SMC protein, putative	
PF11_0316	hypothetical protein					
PF11_0315	hypothetical protein					
PF11_0314	26S protease subunit regulatory subunit 6a, putative	ATPase activity, endopeptidase activity	proteolysis	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0313	ribosomal phosphoprotein P0	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0312	ribosomal protein L38e	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0311	N-acetyl glucosamine phosphate mutase, putative	phosphoacetylglucosamine mutase activity	glucosamine metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0310	transporter putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0309	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0308	hypothetical protein					
PF11_0307	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0306	A/G-specific adenine glycosylase, putative	DNA N-glycosylase activity, oxidized pyrimidine base lesion DNA N-glycosylase activity	base-excision repair	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0305	hypothetical protein					
PF11_0304	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0303	26S proteasome regulatory complex subunit, putative	endopeptidase activity	proteolysis	proteasome complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0302	hypothetical protein					
PF11_0301	spermidine synthase	spermidine synthase activity	spermidine biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0300	hypothetical protein					
PF11_0299	hypothetical protein					
PF11_0298	GPI8p transamidase	cysteine-type endopeptidase activity, legumain activity	proteolysis	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0297	hypothetical protein					
PF11_0296	hypothetical protein					
PF11_0295	farnesyl pyrophosphate synthase, putative	geranyltranstransferase activity	isoprenoid biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0294	ATP-dependent phosphofructokinase, putative	6-phosphofructokinase activity	glycolysis	6-phosphofructokinase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0293	multiprotein bridging factor type 1, putative	transcription coactivator activity	regulation of transcription, DNA-dependent	cellular_component		
PF11_0292	hypothetical protein					
PF11_0291	hypothetical protein					
PF11_0290	hypothetical protein					
PF11_0289	hypothetical protein					
PF11_0288	hypothetical protein					
PF11_0287	hypothetical protein					
PF11_0286	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane		
PF11_0285	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0284	methyltransferase, putative	methyltransferase activity	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0283	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0282	deoxyuridine 5'-triphosphate nucleotidohydrolase, putative	dUTP diphosphatase activity	DNA replication, tRNA metabolic process	cellular_component	dUTPase; dUTP pyrophosphatase;	<b>attribution</b>:
PF11_0281	hypothetical protein					
PF11_0280	small nuclear ribonucleoprotein F, putative	molecular_function	biological_process	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0279	hypothetical protein					
PF11_0278	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0277	hypothetical protein					
PF11_0276	hypothetical protein					
PF11_0275	hypothetical protein					
PF11_0274	hypothetical protein					
PF11_0273	hypothetical protein					
PF11_0272	ribosomal protein S18, putative	structural constituent of ribosome	translation	small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0271	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF11_0270	threonine -- tRNA ligase, putative	ATP binding, threonine-tRNA ligase activity	threonyl-tRNA aminoacylation	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0269	hypothetical protein					
PF11_0268	hypothetical protein					
PF11_0267	hypothetical protein					
PF11_0266	small nuclear ribonucleoprotein D1, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	small nuclear ribonucleoprotein complex		
PF11_0265	mitochondrial import inner membrane translocase, putative	protein translocase activity	protein targeting to mitochondrion	mitochondrial inner membrane, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0264	DNA-dependent RNA polymerase	DNA binding, DNA-directed RNA polymerase activity	transcription	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0263	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0262	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0261	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0260	ribosomal protein L35, putative	structural constituent of ribosome	translation	large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0259	hypothetical protein					
PF11_0258	co-chaperone GrpE, putative	unfolded protein binding	protein import into mitochondrial matrix	mitochondrial matrix, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0257	ethanolamine kinase, putative	ethanolamine kinase activity	lipid metabolic process, phosphatidylcholine biosynthetic process, phosphatidylethanolamine biosynthetic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0256	pyruvate dehydrogenase E1 component, alpha subunit, putative	pyruvate dehydrogenase (acetyl-transferring) activity	tricarboxylic acid cycle	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0255	hypothetical protein					
PF11_0254	hypothetical protein					
PF11_0253	hypothetical protein					
PF11_0252	hypothetical protein					
PF11_0251	endoplasmic reticulum oxidoreductin, putative	oxidoreductase activity	protein folding	endoplasmic reticulum, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0250	high mobility group-like protein NHP2, putative	molecular_function	biological_process	nucleus	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0249	hypothetical protein					
PF11_0248	hypothetical protein					
PF11_0247	hypothetical protein					
PF11_0246	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0245	translation elongation factor EF-1, subunit alpha, putative	GTP binding, translation elongation factor activity	translational elongation	eukaryotic translation elongation factor 1 complex	EF-1 alpha	<b>attribution</b>:
PF11_0244	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0243	leucine-rich repeat protein 11, LRR11					
PF11_0242	protein kinase	protein kinase activity	protein amino acid phosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0241	hypothetical protein					
PF11_0240	dynein heavy chain, putative	motor activity	microtubule-based movement	dynein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0239	protein kinase, FIKK family				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0238	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0237	hypothetical protein					
PF11_0236	hypothetical protein					
PF11_0235	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0234	hypothetical protein					
PF11_0233	hypothetical protein					
PF11_0232	hypothetical protein					
PF11_0231	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0230	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0229	hypothetical protein					
PF11_0228	hypothetical protein					
PF11_0227	serine/threonine protein kinase, puative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0226	petidase, M16 family				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0225	PfGCN20	ATP binding, ATPase activity, coupled to transmembrane movement of substances	regulation of translation, transport	membrane		
PF11_0224	circumsporozoite-related antigen	molecular_function	biological_process	membrane	CRA; EXP-1;	
PF11_0223	hypothetical protein					
PF11_0222	hypothetical protein					
PF11_0221	hypothetical protein					
PF11_0220	protein kinase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0219	hypothetical protein					
PF11_0218	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0217	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0216	hypothetical protein					
PF11_0215	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0214	hypothetical protein					
PF11_0213	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0212	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0211	hypothetical protein, conserved	molecular_function	biological_process	apicoplast, cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0210	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0209	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0208	phosphoglycerate mutase, putative	phosphoglycerate mutase activity	glycolysis	cytosol	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0207	hypothetical protein					
PF11_0206	hypothetical protein					
PF11_0205	hypothetical protein					
PF11_0204	hypothetical protein					
PF11_0203	peptidase	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0202	clathrin coat assembly protein, putative	molecular_function	vesicle-mediated transport	clathrin adaptor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0201	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0200	U2 snRNP auxiliary factor, small subunit, putative	RNA binding	nuclear mRNA splicing, via spliceosome	snRNP U2	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0199	hypothetical protein					
PF11_0198	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF11_0197	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0196	hypothetical protein					
PF11_0195	hypothetical protein					
PF11_0194	hypothetical protein					
PF11_0193	hypothetical protein					
PF11_0192	hypothetical protein					
PF11_0191	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0190	hypothetical protein					
PF11_0189	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0188	heat shock protein 90, putative	ATP binding, ATPase activity	response to heat, response to unfolded protein	mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0187	clathrin assembly protein AP19, putative	molecular_function	vesicle-mediated transport	clathrin adaptor complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0186	hypothetical protein					
PF11_0185	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0184	DNA mismatch repair protein MLH1, putative	ATP binding, ATPase activity	mismatch repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0183	GTP-binding nuclear protein ran/tc4	GTP binding, GTPase activity	RNA export from nucleus, intracellular protein transport, regulation of progression through cell cycle	nucleus	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0182	hypothetical protein					
PF11_0181	tyrosine --tRNA ligase, putative	ATP binding, tyrosine-tRNA ligase activity	tyrosyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0180	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0179	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0178	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0177	ubiquitin C-terminal hydrolase, family 1, putative	ubiquitin thiolesterase activity	ubiquitin-dependent protein catabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0176	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0175	heat shock protein 101, putative		response to heat, response to unfolded protein	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0174	cathepsin C, homolog				human DPAP cathepsin C homolog;P. falciparum DPAP1;	<b>attribution</b>:
PF11_0173	oligosacharyl transferase STT3 subunit, putative	oligosaccharyl transferase activity	protein amino acid glycosylation	integral to membrane, integral to plasma membrane, membrane, oligosaccharyl transferase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0172	folate/biopterin transporter, putative	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0171	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0170	cyclophilin, putative	peptidyl-prolyl cis-trans isomerase activity	protein folding	cellular_component		
PF11_0169	hypothetical protein					
PF11_0168	hypothetical protein					
PF11_0167	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0166	hypothetical protein					
PF11_0165	falcipain 2 precursor	cysteine-type endopeptidase activity	proteolysis	food vacuole, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0164	peptidyl-prolyl cis-trans isomerase	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding	cellular_component	PfCyp; cyclophilin;	
PF11_0163	hypothetical protein					
PF11_0162	falcipain-3	cysteine-type endopeptidase activity	proteolysis	food vacuole, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0161	falcipain-2 precursor, putative	cysteine-type endopeptidase activity	proteolysis	food vacuole, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0160	hypothetical protein					
PF11_0535	hypothetical protein, conserved				annotation change, 120405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF11_0525	hypothetical protein	molecular_function	biological_process	apicoplast	annotation change, 120405, new gene model defined after TBLASTX comparison with P. knowlesi	
PF11_0159	hypothetical protein					
PF11_0158	hypothetical protein					
PF11_0157	glycerol-3-phosphate dehydrogenase, putative	glycerol-3-phosphate dehydrogenase (NAD+) activity	glycerol-3-phosphate metabolic process	glycerol-3-phosphate dehydrogenase complex, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0156	serine/threonine protein kinase	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0155	hypothetical protein					
PF11_0154	hypothetical protein					
PF11_0153	hypothetical protein					
PF11_0152	hypothetical protein					
PF11_0151	GTPase activating protein, GAP				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0150	rhomboid protease, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0149	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0148	dynein light chain type 2, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0147	mitogen-activated protein kinase 2,	ATP binding, MAP kinase activity	MAPKKK cascade, protein amino acid phosphorylation, signal transduction	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0146	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0145	glyoxalase I, putative	lactoylglutathione lyase activity	methylglyoxal metabolic process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0144	hypothetical protein					
PF11_0143	hypothetical protein					
PF11_0142	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF11_0141	UDP-galactose transporter, putative	UDP-galactose transporter activity	UDP-galactose transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0140	hypothetical protein					
PF11_0139	protein tyrosine phosphatase, putative	protein tyrosine phosphatase activity	protein amino acid dephosphorylation	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0528	hypothetical protein					
PF11_0136	hypothetical protein					
PF11_0135	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0134	hypothetical protein					
PF11_0527	hypothetical protein					
PF11_0131	hypothetical protein					
PF11_0526	hypothetical protein					
PF11_0130	hypothetical protein					
PF11_0129	hypothetical protein					
PF11_0128	coq4 homolog, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0127	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0126	hypothetical protein					
PF11_0125	hypothetical protein					
PF11_0124	hypothetical protein					
PF11_0123	hypothetical protein					
PF11_0122	hypothetical protein					
PF11_0120	hypothetical protein					
PF11_0119	syntaxin, putative	molecular_function	biological_process	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0118	hypothetical protein					
PF11_0117	replication factor C subunit 5, putative		DNA replication, DNA strand elongation during DNA replication	DNA replication factor C complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0116	hypothetical protein					
PF11_0115	hypothetical protein					
PF11_0114	actin-like protein homolog, ALP1 homolog	structural constituent of cytoskeleton	cytoskeleton organization and biogenesis	actin filament	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0113	ribosomal protein L11, putative	structural constituent of ribosome	translation	organellar large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0112	vacuolar sorting protein 35, putative	molecular_function	retrograde transport, endosome to Golgi	membrane coat		
PF11_0111	asparagine-rich antigen					
PF11_0110	hypothetical protein	molecular_function	biological_process	apicoplast, membrane		
PF11_0109	hypothetical protein					
PF11_0108	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF11_0107	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0550	hypothetical protein, conserved					
PF11_0106	60S Ribosomal protein L36, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community), membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0105	hypothetical protein				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0540	hypothetical protein					
PF11_0101	hypothetical protein					
PF11_0100	hypothetical protein					
PF11_0099	heat shock protein DnaJ homologue Pfj2	unfolded protein binding	protein folding, response to heat	apicoplast, mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0098	endoplasmic reticulum-resident calcium binding protein	calcium ion binding	intracellular protein transport	endoplasmic reticulum	PfERC;	
PF11_0097	succinyl-CoA synthetase alpha subunit, putative	succinate-CoA ligase (GDP-forming) activity	succinyl-CoA metabolic process, tricarboxylic acid cycle	membrane, mitochondrial matrix, mitochondrion, succinate-CoA ligase complex (GDP-forming)	NULL;	<b>attribution</b>:
PF11_0096	casein kinase II, alpha subunit, putative	protein kinase CK2 activity	protein amino acid phosphorylation	protein kinase CK2 complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0095a	pterin-4a-carbinolamine dehydratase				New gene model added to annotation (050407) from published experimental data (PMID:16337017) characterising this enzyme in strain K1. mRNA (EMBL:DQ223776), protein (UNIPROT:Q2Q450_PLAFA).	Pfpcd
PF11_0095	hypothetical protein, conserved	molecular_function	biological_process	cellular_component		
PF11_0094	hypothetical protein					
PF11_0093	hypothetical protein				NULL;	
PF11_0092	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0091	hypothetical protein				NULL;	
PF11_0090	hypothetical protein				NULL;	<b>attribution</b>:
PF11_0089	hypothetical protein				NULL;	
PF11_0088	hypothetical protein				NULL;	
PF11_0087	Rad51 homolog, putative	ATP binding, DNA binding, DNA-dependent ATPase activity, damaged DNA binding, recombinase activity	DNA recombination, DNA repair	nucleus	NULL;	
PF11_0086	hypothetical protein				NULL;	
PF11_0085	hypothetical protein				NULL;	
PF11_0084	hypothetical protein				NULL;	
PF11_0083	nucleic acid binding factor, putative	nucleic acid binding	nucleobase, nucleoside, nucleotide and nucleic acid metabolic process	cellular_component	NULL;	
PF11_0524	U6 snRNA associated Sm-like protein Ls; U6 snRNA associated Sm-like protein LsM4, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0080	hypothetical protein				NULL;	
PF11_0079	hypothetical protein					
PF11_0078	hypothetical protein					
PF11_0077	hypothetical protein					
PF11_0076	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0075	hypothetical protein				NULL;	
PF11_0074	exonuclease, putative	molecular_function	biological_process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0073	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0072	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0071	RuvB DNA helicase, putative	ATPase activity, nucleotide binding	DNA recombination, DNA repair	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0070	hypothetical protein				NULL;	
PF11_0069	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0068	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0067	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0066	caltractin (centrin), putative	calcium ion binding, structural constituent of cytoskeleton	mitosis	centrosome, membrane	NULL;	
PF11_0065	ribosomal protein S4, putative	RNA binding, structural constituent of ribosome	translation	mitochondrion, small ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0064	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0063	hypothetical protein				NULL;	
PF11_0062	histone H2B	DNA binding	chromosome organization and biogenesis (sensu the Eukaryota research community)	nucleosome	NULL;	<b>attribution</b>:
PF11_0061	histone H4, putative	DNA binding	chromosome organization and biogenesis (sensu the Eukaryota research community)	nucleosome	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0060	protein kinase				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0059	metabolite/drug transporter	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0058	rna polymerase subunit, putative	molecular_function	biological_process	cellular_component, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0057	hypothetical protein				NULL;	
PF11_0056	hypothetical protein				NULL;	
PF11_0055	hypothetical protein	molecular_function	biological_process	apicoplast		
PF11_0054	hypothetical protein				NULL;	
PF11_0053	PfSNF2L	ATP binding, ATP-dependent helicase activity, DNA-dependent ATPase activity	chromatin remodeling, regulation of transcription, DNA-dependent	chromatin remodeling complex	1 frameshift;	
PF11_0052	syntaxin, putative	molecular_function	biological_process	apicoplast, membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0051	phenylalanine -- tRNA ligase, putative	phenylalanine-tRNA ligase activity	phenylalanyl-tRNA aminoacylation	phenylalanine-tRNA ligase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0050	hypothetical protein				NULL;	
PF11_0049	hypothetical protein, conserved	molecular_function	biological_process	cellular_component, membrane	NULL;	
PF11_0048	casein kinase II beta chain, putative	protein kinase CK2 activity	protein amino acid phosphorylation	protein kinase CK2 complex	NULL;	<b>attribution</b>:
PF11_0047	hypothetical protein				NULL;	
PF11_0046	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0045	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
PF11_0044	hypothetical protein	molecular_function	biological_process	apicoplast	NULL;	
1399.pre-tRNA-Leu-1	tRNA Leucine				anticodon CCA ,cove score 72.42	
1399.pre-tRNA-Gly-1	tRNA Glycine				anticodon TCC, cove score 69.10	
PF11_0043	60S acidic ribosomal protein p1, putative	structural constituent of ribosome	translation	large ribosomal subunit	NULL;	<b>attribution</b>:
PF11_0042	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0041	hypothetical protein				NULL;	
PF11_0040	early transcribed membrane protein 11.2, etramp11.2	molecular_function	biological_process	integral to membrane, membrane		
PF11_0039	early transcribed membrane protein 11.1, etramp11.1	molecular_function	biological_process	integral to membrane, membrane		
PF11_0038	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0037	hypothetical protein	molecular_function	biological_process	membrane	NULL;	
PF11_0036	hypothetical protein, conserved	molecular_function	biological_process	cellular_component	NULL;	
PF11_0035	hypothetical protein				NULL;	
PF11_0034	hypothetical protein	molecular_function	biological_process	membrane		
PF11_0033	hypothetical protein				hypothetical protein {Plasmodium falciparum 3D7;}	
PF11_0523	erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0026	hypothetical protein				NULL;	
PF11_0025	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 11.2	molecular_function	biological_process	apicoplast, membrane	NULL;	PfMC-2TM_11.2
PF11_0024	hypothetical protein				hypothetical protein, conserved in P. falciparum {Plasmodium falciparum 3D7;}	
PF11_0023	hypothetical protein	molecular_function	biological_process	membrane	hypothetical protein {Plasmodium falciparum 3D7;}	annotation change, aeb, 280607. Gene model modified on basis of comparison to paralogs. First exon defined
PF11_0022	pseudogene, rifin, degenerate, putative					
PF11_0021	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0020	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0529	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0522	pseudogene, erythrocyte membrane protein 1 (PfEMP1), truncated				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF11_0016	hypothetical protein					
PF11_0015	hypothetical protein					
PF11_0014	Plasmodium falciparum Maurer's Cleft 2 transmembrane domain protein 11.1, PfMC-2TM_11.1	molecular_function	biological_process	membrane	PfMC-2TM_11.1	
PF11_0013	stevor, putative, degenerate	molecular_function	biological_process	Maurer's cleft, membrane		
PF11_0012	hypothetical protein					
PF11_0011	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0010	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0009	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane		
PF11_0008	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob, membrane	PfEMP-1;	<b>attribution</b>:
PF11_0007	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding, host cell surface receptor binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	PfEMP1;	<b>attribution</b>:
PFE1640w	erythrocyte membrane protein 1 (PfEMP1), truncated				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1635w	RIF pseudogene, RIFIN pseudogene				Rifin pseudogene resembling exon 2, contains one codon, truncated at the 3' terminus by c 100 bp	RIF pseudogene
PFE1630w	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	2 probable transmembrane helices predicted by TMHMM2.0 at aa 126-148 and 276-298
PFE1625c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR-related fragment
PFE1620c	erythrocyte membrane protein 1 (PfEMP1)				VAR-related fragment	VAR pseudogene
PFE1615c	hypothetical protein			apicoplast		
PFE1610w	hypothetical protein			apicoplast		
PFE1605w	DNAJ protein				Similar to Plasmodium falciparum protein with DNAJ domain pfb0920W TR:O96276 (EMBL:AE001425) (1014 aa) fasta scores: E(): 2.2e-10, 23.800% id in 479 aa	1 probable transmembrane helix predicted by TMHMM2.0 at aa 47-66
PFE1600w	hypothetical protein, conserved in P. falciparum					
PFE1595c	hypothetical protein, conserved			apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.200, signal anchor probability 0.751) with cleavage site probability 0.099 between residues 26 and 27	1 probable transmembrane helix predicted by TMHMM2.0 at aa 2-24
PFE1590w	early transcribed membrane protein 5, ETRAMP5				ETRAMP5	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.989, signal anchor probability 0.000) with cleavage site probability 0.950 between residues 24 and 25
MAL5_28S						
MAL5_ITS2					hit to internal 1..196 score: 276 percent id: 92.00 transcribed spacer 1 (falcip asexual)	
MAL5_5.8S						
MAL5_ITS1						
MAL5_18S						
PFE1570c	hypothetical protein, conserved					
PFE1565w	hypothetical protein, conserved					
PFE1560c	hypothetical protein, conserved					
PFE1555c	hypothetical protein, conserved					
PFE1550w	hypothetical protein, conserved				2 probable transmembrane helices predicted by TMHMM2.0 at aa 219-238 and 682-704	
PFE1545c	diaphanous homolog, putative		actin cytoskeleton organization and biogenesis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1540w	hypothetical protein, conserved					
PFE1535w	hypothetical protein, conserved					
PFE1530c	hypothetical protein, conserved				Similar to Drosophila melanogaster Cg12259 protein cg12259 TR:Q9VAY7 (EMBL:AE003763) (359 aa) fasta scores: E(): 1.4e-23, 41.778% id in 225 aa	
PFE1525w	hypothetical protein, conserved			apicoplast	10 probable transmembrane helices predicted by TMHMM2.0 at aa 5-27, 203-225, 284-306, 327-349, 408-430, 466-488, 521-543, 590-609, 619-641 and 662-684	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.743, signal anchor probability 0.252) with cleavage site probability 0.464 between residues 24 and 25
PFE1520c	hypothetical protein, conserved					
PFE1515w	hypothetical protein, conserved					
PFE1510c	phosphoenolpyruvate:phosphate antiporter, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1505w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 205-224	Weak similarity to Arabidopsis thaliana syntaxin 52 syp52 TR:AAK40224 (EMBL:AF355756) (233 aa) fasta scores: E(): 0.0059, 26.829% id in 205 aa
PFE1500c	hypothetical protein, conserved					
PFE1495w	hypothetical protein				GPI-Anchor Signal predicted for PFE1495w by DGPI v2.04, no cleavage site predicted	
PFE1490c	hypothetical protein, conserved				4 probable transmembrane helices predicted by TMHMM2.0 at aa 59-81, 94-116, 146-163 and 178-200	
PFE1485w	hypothetical protein, conserved					
PFE1480c	hypothetical protein, conserved					
MAL5_tRNA_Arg1	tRNA Arginine				Arg tRNA, TCG anticodon, Cove score 66.19	
PFE1470w	cell cycle regulator protein, putative	RNA binding	regulation of progression through cell cycle		Similar to Drosophila melanogaster Cg5941 protein cg5941 TR:Q9W445 (EMBL:AE003436) (182 aa) fasta scores: E(): 3.6e-32, 50.292% id in 171 aa, and to Homo sapiens multiple copies in a t-cell malignancies mct-1 TR:Q9ULC4 (EMBL:AB034206) (181 aa) fasta scores: E(): 1.6e-31, 50.000% id in 170 aa	
PFE1465w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 923-945	
PFE1460w	hypothetical protein, conserved			apicoplast	Weak similarity to Guillardia theta Tic22 tic22 TR:AAK39834 (EMBL:AF165818) (307 aa) fasta scores: E(): 1.5e-10, 26.471% id in 272 aa	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.989, signal anchor probability 0.000) with cleavage site probability 0.594 between residues 17 and 18
PFE1455w	sugar transporter, putative	sugar porter activity	carbohydrate transport	integral to membrane	Similar to Staphylococcus xylosus lactose permease lacP SW:LACP_STAXY (O33814) (462 aa) fasta scores: E(): 9.5e-09, 22.247% id in 445 aa, and to Salmonella typhimurium melibiose carrier protein melB SW:MELB_SALTY (P30878) (476 aa) fasta scores: E(): 8.2e-06, 19.753% id in 486 aa, and to Bacillus subtilis probable glucitol transport protein GutA gutA SW:GUTA_BACSU (O34368) (463 aa) fasta scores: E(): 0.00019, 23.094% id in 459 aa	<b>attribution</b>:
PFE1450c	hypothetical protein, conserved				Similar to Guillardia theta hypothetical 16.5 kDa protein TR:Q9AW19 (EMBL:AJ010592) (139 aa) fasta scores: E(): 1.1e-11, 40.594% id in 101 aa	1 probable transmembrane helix predicted by TMHMM2.0 at aa 5-27
PFE1445c	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted by TMHMM2.0 at aa 12-34 and 678-697	Similar to Macaca fascicularis hypothetical 30.5 kDa protein TR:BAB60741 (EMBL:AB062962) (272 aa) fasta scores: E(): 3e-23, 35.943% id in 281 aa
PFE1440c	hypothetical protein, conserved				gene name changed from PFE1430c, due to duplication	This gene comprises a break in conserved synteny between with P. knowlesi and P yoelii
PFE1435c	hypothetical protein, conserved				Similar to Saccharomyces cerevisiae hypothetical GTP-binding protein in ynd1-pac2 intergenic region yer006W SW:YEJ6_YEAST (P40010) (520 aa) fasta scores: E(): 4.6e-05, 24.046% id in 524 aa GTP-ase domain of unknown function	
PFE1430c	cyclophilin, putative	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding		Similar to Arabidopsis thaliana cyclophilin-like protein at2g36130 TR:Q9SIH1 (EMBL:AC007135) (164 aa) fasta scores: E(): 6.8e-38, 66.443% id in 149 aa. Probably does not bind cyclosporin A because contains His at position 156, not Trp.	
PFE1425c	hypothetical protein, conserved				annotation change, aeb, 121104, gene model modified, coordinates of exon1 and 2 redefined on the basis of SNAP gene prediction and the comparison of exon structure in this region with P. knowlesi and P. yoelii	
PFE1420w	F-actin capping protein, alpha subunit, putative				Similar to Arabidopsis thaliana alpha subunit of f-actin capping protein f22f7.3 TR:Q9MA66 (EMBL:AC009606) (308 aa) fasta scores: E(): 1.1e-05, 23.358% id in 274 aa, and to Drosophila melanogaster f-actin capping protein alpha subunit cpa or cg10540 SW:CAPA_DROME (Q9W2N0) (286 aa) fasta scores: E(): 1.2e-05, 22.464% id in 276 aa, and to Gallus gallus f-actin capping protein alpha-1 subunit SW:CAZ1_CHICK (P13127) (286 aa) fasta scores: E(): 5.8e-05, 21.818% id in 275 aa, and to Dictyostelium discoideum f-actin capping protein alpha subunit abpD SW:CAPA_DICDI (P13022) (281 aa) fasta scores: E(): 0.00012, 23.684% id in 266 aa; contains a Pfam:F-actin_cap_A domain	<b>attribution</b>:
PFE1415w	cell cycle regulator with zn-finger domain, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1410c	hypothetical protein, conserved					
PFE1405c	eukaryotictranslation initiation factor 3, subunit 6, putative				Similar to Homo sapiens eukaryotictranslation initiation factor 3, subunit 6 TR:Q9BRV2 (EMBL:BC005944) (396 aa) fasta scores: E(): 2e-19, 30.714% id in 280 aa	<b>attribution</b>:
PFE1400c	beta adaptin protein, putative		vesicle-mediated transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1395c	hypothetical protein, conserved				Weakly similar to Arabidopsis thaliana unknown protein f1n21.15 TR:AAK73254 (EMBL:AY044313) (141 aa) fasta scores: E(): 2.9, 30.928% id in 97 aa	
PFE1390w	RNA helicase-1	ATP-dependent RNA helicase activity			Similar to Plasmodium falciparum RNA helicase-1 TR:Q9U936 (EMBL:AJ245474) (386 aa) fasta scores: E(): 2e-126, 100.000% id in 380 aa	Identitity starts at amino acid position 222 of the (EMBL:AJ245474) protein
MAL5_tRNA_Leu2	tRNA Leucine				TAA anticodon, Cove score 70.73	
MAL5_tRNA_Glu1	tRNA Glutamic acid				TTC anticodon, Cove score = 74.15	
PFE1375c	hypothetical protein, conserved			apicoplast	asparagine-rich	
PFE1370w	hsp70 interacting protein, putative					
PFE1365w	hypothetical protein, conserved				2 probable transmembrane helices predicted by TMHMM2.0 at aa 99-121 and 136-158	
PFE1363c	hypothetical protein				annotation change, aeb, 110405, new gene model defined after TBLASTX comparison with P. knowlesi	
PFE1360c	methionine aminopeptidase, putative	methionyl aminopeptidase activity	proteolysis		Similar to Arabidopsis thaliana methionine aminopeptidase TR:Q9FV52 (EMBL:AF250961) (369 aa) fasta scores: E(): 4.7e-39, 46.809% id in 235 aa	<b>attribution</b>:
PFE1355c	ubiquitin carboxyl-terminal hydrolase, putative	ubiquitin-specific protease activity	protein deubiquitination		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1350c	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1345c	minichromosome maintenance protein 3, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1340w	transmembrane protein, putative			membrane	2 probable transmembrane helices predicted by TMHMM2.0 at aa 10-32 and 182-204	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.998, signal anchor probability 0.001) with cleavage site probability 0.732 between residues 27 and 28
PFE1335c	hypothetical protein, conserved					
PFE1330c	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted by TMHMM2.0 at aa 5-27 and 758-780	
PFE1325w	hypothetical protein, conserved					
PFE1320w	hypothetical protein, conserved					
PFE1315w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 63-85	
PFE1310c	hypothetical protein, conserved				Contains 5 WD40 domains	
PFE1305c	hypothetical protein, conserved				annotation change, aeb, 111104, gene model modified defined on the basis of comparison with P knowlesi and P yoelii. Four new 5' exons defined.	Asparagine-rich
PFE1300w	hypothetical protein, conserved			apicoplast	annotation change, aeb, 121104, gene model modified, intron defined after PHE317 resulting in the loss of 83 amino acids form the predicted protein sequence.	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.042, signal anchor probability 0.957) with cleavage site probability 0.030 between residues 27 and 28
PFE1295c	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted by TMHMM2.0 at aa 417-439 and 459-481	
PFE1290w	serine/threonine-protein kinase. Pfnek-2	protein serine/threonine kinase activity, protein-tyrosine kinase activity	protein amino acid phosphorylation	cellular_component	Pfnek-2	Similar to Mus musculus serine/threonine-protein kinase Nek1 nek1 SW:NEK1_MOUSE (P51954) (774 aa) fasta scores: E(): 4.1e-18, 39.459% id in 185 aa
PFE1285w	hypothetical protein, conserved					
PFE1280w	hypothetical protein, conserved				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.995, signal anchor probability 0.000) with cleavage site probability 0.969 between residues 19 and 20	
PFE1275c	RNA methyltransferase, putative	RNA binding, RNA methyltransferase activity	RNA processing		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1270c	hypothetical protein, conserved				Contains WD40 repeats	
PFE1265w	G-protein coupled receptor, putative	G-protein coupled receptor activity	G-protein coupled receptor protein signaling pathway	integral to plasma membrane	Similar to Homo sapiens testis-specific adriamycin sensitivity protein tasp or lancl2 TR:Q9NS86 (EMBL:AB035966) (450 aa) fasta scores: E(): 4e-17, 29.385% id in 439 aa, and to Homo sapiens seven transmembrane domain protein p40 or lancl1 TR:O43813 (EMBL:Y11395) (399 aa) fasta scores: E(): 4.5e-15, 28.261% id in 460 aa	7 probable transmembrane helices predicted by TMHMM2.0 at aa 47-64, 92-114, 172-191, 211-233, 325-344, 374-396 and 430-447
PFE1260c	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 91-113	Asparagine-rich
PFE1255w	hypothetical protein, conserved					
PFE1250w	acetyl-CoA synthetase, PfACS10	long-chain-fatty-acid-CoA ligase activity	fatty acid metabolic process		Similar to Callithrix jacchus long-chain fatty acid CoA ligase mlcl1 TR:Q9GLP3 (EMBL:AF190741) (698 aa) fasta scores: E(): 4.5e-77, 36.884% id in 629 aa	<b>attribution</b>:
PFE1245w	hypothetical protein, conserved	nucleic acid binding			Putative zinc finger protein, length = 704 aa	
PFE1240w	hypothetical protein, conserved				Similar to Arabidopsis thaliana hypothetical 73.0 kDa protein f22h5.13 TR:Q9FRL1 (EMBL:AC025814) (654 aa) fasta scores: E(): 9.4e-79, 54.568% id in 405 aa	Similar to Homo sapiens cdna flj10900 fis, clone nt2rp5003522, weakly similar to NADPH- cytochrome p450 reductase TR:Q9NV66 (EMBL:AK001762) (732 aa) fasta scores: E(): 1.9e-78, 56.136% id in 383 aa belonging to moaA/nifB/pqqE family
PFE1235c	hypothetical protein				Weakly similar to Arabidopsis thaliana similar to ufd1 protein at4g15420 TR:O23395 (EMBL:Z97338) (778 aa) fasta scores: E(): 1.3e-08, 20.786% id in 611 aa	
PFE1230c	hypothetical protein, conserved				Putative conserved hypothetical protein	1 probable transmembrane helix predicted by TMHMM2.0 at aa 58-77
PFE1225w	50S ribosomal subunit protein L12, putative	structural constituent of ribosome	translation	apicoplast, large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1220w	hypothetical protein, conserved					
PFE1215c	developmentally regulated GTP-binding protein 1, putative				Similar to Homo sapiens developmentally regulated GTP-binding protein 1 drg1 SW:DRG1_HUMAN (Q9Y295) (367 aa) fasta scores: E(): 8.6e-100, 71.858% id in 366 aa, and to Arabidopsis thaliana GTP-binding-like protein f23k16.150 or at4g39520 TR:Q9SVA6 (EMBL:AL078620) (369 aa) fasta scores: E(): 1.3e-99, 69.945% id in 366 aa	
PFE1210c	hypothetical protein, conserved					
PFE1205c	hypothetical protein, conserved				4 probable transmembrane helices predicted by TMHMM2.0 at aa 7-26, 46-65, 78-97 and 112-129	
PFE1200w	hypothetical protein, conserved					
PFE1195w	karyopherin beta			nuclear pore	Similar to Plasmodium falciparum karyopherin beta kp1 TR:AAF98803 (EMBL:AF256227) (599 aa) fasta scores: E(): 1.7e-217, 99.499% id in 599 aa	<b>attribution</b>:
PFE1190c	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted by TMHMM2.0 at aa 20-42 and 52-69	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.072, signal anchor probability 0.904) with cleavage site probability 0.017 between residues 21 and 22
PFE1185w	transporter, putative	transporter activity	transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1180c	hypothetical protein, conserved				4 probable transmembrane helices predicted by TMHMM2.0 at aa 978-1000, 1021-1040, 1064-1083 and 1104-1126	
PFE1175w	hypothetical protein, conserved					
PFE1173c	outer arm dynein lc3, putative				SNAP prediction, on sequence MAL5 score 13.502	annotation change, aeb, 121104; new gene model defined after SNAP analysis
PFE1170w	hypothetical protein				2 probable transmembrane helices predicted by TMHMM2.0 at aa 56-78 and 91-113	Similar to Plasmodium falciparum protein with DNAJ domain pfb0920W TR:O96276 (EMBL:AE001425) (1014 aa) fasta scores: E(): 8.9e-23, 33.501% id in 397 aa
PFE1165c	hypothetical protein, conserved					
PFE1160w	hypothetical protein, conserved					
PFE1155c	mitochondrial processing peptidase alpha subunit, putative	mitochondrial processing peptidase activity, ubiquinol-cytochrome-c reductase activity		mitochondrion	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1150w	multidrug resistance protein	ATPase activity, coupled to transmembrane movement of substances, multidrug efflux pump activity	response to drug	integral to membrane	11 probable transmembrane helices predicted by TMHMM2.0 at aa 56-78, 93-115, 166-188, 192-211, 276-298, 318-340, 789-811, 831-853, 904-926, 930-949 and 1024-1046	PfMDR1
PFE1145w	hypothetical protein, conserved					
PFE1140c	G10 protein, putative				Similar to Drosophila melanogaster l l(1)10bb or lethal or cg1639 TR:O97454 (EMBL:AE003485) (144 aa) fasta scores: E(): 1.1e-32, 57.931% id in 145 aa	
PFE1135w	hypothetical protein, conserved			apicoplast	Similar to Galdieria sulphuraria hypothetical 12.5 kDa protein TR:Q9MSA1 (EMBL:AF233069) (112 aa) fasta scores: E(): 1.8e-13, 41.593% id in 113 aa	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.998, signal anchor probability 0.000) with cleavage site probability 0.987 between residues 18 and 19
PFE1130w	hypothetical protein, conserved				8 probable transmembrane helices predicted by TMHMM2.0 at aa 20-42, 62-84, 88-107, 114-136, 156-175, 273-292, 302-324 and 331-353	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.064, signal anchor probability 0.914) with cleavage site probability 0.032 between residues 35 and 36
PFE1125w	50S ribosomal subunit protein L17, putative	structural constituent of ribosome	translation	mitochondrial large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1120w	hypothetical protein, conserved				3 probable transmembrane helices predicted by TMHMM2.0 at aa 264-286, 2038-2060 and 2199-2221	
PFE1115c	s-adenosylmethionine-dependent methyltransferase, putative	S-adenosylmethionine-dependent methyltransferase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1110w	hypothetical protein, conserved					
PFE1105c	hypothetical protein, conserved					
PFE1100w	hypothetical protein, conserved					
PFE1095w	hypothetical protein, conserved					
PFE1090w	nuceotide binding protein, putative				Similar to Rickettsia prowazekii putative ATPase n2b rp212 TR:Q9ZDV7 (EMBL:AJ235270) (357 aa) fasta scores: E(): 1.1e-18, 31.661% id in 319 aa, and to Neisseria meningitidis (serogroup A) putative nucleotide-binding protein nma1520 or nmb1306 TR:Q9JRK2 (EMBL:AL162756) (383 aa) fasta scores: E(): 1.7e-14, 27.632% id in 304 aa	
PFE1085w	DEAD-box subfamily ATP-dependent helicase, putative				Similar to Homo sapiens dead-box protein 1 ddx1 SW:DDX1_HUMAN (Q92499) (740 aa) fasta scores: E(): 1.8e-25, 29.487% id in 858 aa	
PFE1080w	ribosomal large subunit pseudouridylate synthase, putative	pseudouridylate synthase activity	rRNA processing		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1075c	hypothetical protein, conserved			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.989, signal anchor probability 0.000) with cleavage site probability 0.844 between residues 20 and 21	
PFE1070c	hypothetical protein, conserved					
PFE1065w	hypothetical protein, conserved					
PFE1060c	hypothetical protein, conserved					
PFE1055c	hypothetical protein, conserved					
PFE1050w	adenosylhomocysteinase(S-adenosyl-L-homocystein e hydrolase)	adenosylhomocysteinase activity	one-carbon compound metabolic process		Similar to Plasmodium falciparum adenosylhomocysteinase SW:SAHH_PLAF7 (P50250) (479 aa) fasta scores: E(): 2.6e-194, 99.582% id in 479 aa	<b>attribution</b>:
PFE1045c	hypothetical protein, conserved			apicoplast		
PFE1040c	hypothetical protein, conserved					
PFE1035c	BIS(5'-nucleosyl)-tetraphosphatase (diadenosine tetraphosphatase), putative	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity				
PFE1030c	phosphomethylpyrimidine kinase, putative	kinase activity	thiamin biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1025c	hypothetical protein, conserved					
PFE1020w	u6 snRNA-associated sm-like protein Lsm2, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE1015c	hypothetical protein, conserved					
PFE1010w	protein phosphatase 2c, putative	catalytic activity			Weak Similarity to Plasmodium falciparum protein phosphatase 2c TR:O43966 (EMBL:AF023665) (920 aa) fasta scores: E(): 3.6e-06, 23.485% id in 528 aa	
PFE1005w	40S ribosomal subunit protein S9, putative				Similar to Arabidopsis thaliana 40s ribosomal protein-like f8m21_90 TR:Q9LXG1 (EMBL:AL353993) (198 aa) fasta scores: E(): 1.3e-51, 73.184% id in 179 aa, and to Rattus norvegicus 40s ribosomal protein s9 rps9 SW:RS9_RAT (P29314) (193 aa) fasta scores: E(): 3.7e-48, 72.941% id in 170 aa	<b>attribution</b>:
PFE1000c	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted by TMHMM2.0 at aa 7-29	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.131, signal anchor probability 0.846) with cleavage site probability 0.077 between residues 22 and 23
PFE0995c	hypothetical protein, conserved					
PFE0990w	hypothetical protein, conserved					
PFE0985w	hypothetical protein, conserved				Contains NQHQ repeats	
PFE0980c	hypothetical protein, conserved					
PFE0975c	40S ribosomal subunit protein S24, putative				Similar to Arabidopsis thaliana 40s ribosomal protein s24 rps24 SW:RS24_ARATH (Q9SS17) (133 aa) fasta scores: E(): 4.3e-23, 53.906% id in 128 aa	<b>attribution</b>:
PFE0970w	cytochrome c oxidase assembly protein (heme A: farnesyltransferase), putative	prenyltransferase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0965c	vacuolar ATP synthetase, putative	hydrogen ion transporting ATPase activity, rotational mechanism	hydrogen transport	membrane	Similar to Pleurochrysis carterae vacuolar ATP synthase 16 kDa proteolipid subunit vaP SW:VATL_PLECA (Q43362) (164 aa) fasta scores: E(): 7e-34, 61.728% id in 162 aa	<b>attribution</b>:
PFE0960w	50S ribosomal subunit protein L14, putative				Similar to Thermotoga maritima 50s ribosomal protein l14 rpln or tm1490 SW:RL14_THEMA (P38508) (122 aa) fasta scores: E(): 1e-08, 45.000% id in 100 aa	<b>attribution</b>:
PFE0955w	hypothetical protein, conserved				Weak similarity to several histone RNA hairpin binding proteins incl Xenopus laevis oocyte-specific histone RNA stem-loop binding protein 2 slbp2 SW:SLB2_XENLA (Q9YGP6) (250 aa) fasta scores: E(): 5e-05, 26.718% id in 131 aa	
PFE0950c	hypothetical protein, conserved					
PFE0945c	hypothetical protein, conserved					
PFE0940c	hypothetical protein				GPI-Anchor Signal predicted for PFE0940c by DGPI v2.04, no cleavage site predicted	
PFE0935c	RNA-binding protein, putative				Similar to Arabidopsis thaliana similarity to RNA-binding protein TR:Q9LVC3 (EMBL:AB019234) (604 aa) fasta scores: E(): 1.6e-32, 41.353% id in 399 aa	
PFE0930w	hypothetical protein, conserved				Similar to Schizosaccharomyces pombe trp-asp repeat protein spac343.04C TR:Q9UT85 (EMBL:AL109739) (507 aa) fasta scores: E(): 3.7e-26, 29.705% id in 441 aa	
PFE0925c	snrnp protein, putative			apicoplast	Similar to Oryza sativa putative snrnp protein TR:AAK38497 (EMBL:AC087181) (736 aa) fasta scores: E(): 1.3e-74, 40.840% id in 857 aa	<b>attribution</b>:
PFE0920c	cyclin2 related protein, putative				Similar to Trypanosoma brucei cyclin 2 cyc2 TR:Q9NG22 (EMBL:AJ242519) (211 aa) fasta scores: E(): 2.5e-17, 45.736% id in 129 aa	<b>attribution</b>:
PFE0915c	proteasome subunit beta type 1	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0910w	hypothetical protein, conserved				2 probable transmembrane helices predicted by TMHMM2.0 at aa 70-92 and 112-134	
PFE0905w	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted by TMHMM2.0 at aa 12-30	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.058, signal anchor probability 0.712) with cleavage site probability 0.026 between residues 24 and 25
PFE0900w	hypothetical protein, conserved					
PFE0895c	Zinc finger protein, putative	zinc ion binding			Hypothetical protein with probable Zn-finger domain	
PFE0890c	hypothetical protein, conserved					
PFE0885w	eukaryotictranslation initiation factor 3 subunit, putative				Similar to Homo sapiens eukaryotictranslation initiation factor 3 subunit 9 eif3s9 SW:IF39_HUMAN (P55884) (814 aa) fasta scores: E(): 4.7e-19, 30.966% id in 704 aa, and to Arabidopsis thaliana prt1 TR:Q9M4T6 (EMBL:AF255680) (716 aa) fasta scores: E(): 2.3e-27, 30.579% id in 726 aa initiation factor 3 subunit	<b>attribution</b>:
PFE0880c	f-actin capping protein beta subunit, putative		barbed-end actin filament capping	F-actin capping protein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0875c	hypothetical protein, conserved			apicoplast	2 probable transmembrane helices predicted by TMHMM2.0 at aa 10-32 and 37-59	Similar to Arabidopsis thaliana hypothetical 67.9 kDa protein TR:AAK64093 (EMBL:AY040035) (614 aa) fasta scores: E(): 4.8e-38, 30.821% id in 597 aa
PFE0870w	transcriptional regulator, putative		transcription		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0865c	splicing factor, putative		RNA splicing, mRNA processing	spliceosome	Similar to Homo sapiens splicing factor, arginine/serine-rich 1 sfrs1 or sf2p33 or asf or sf2 SW:SFR1_HUMAN (Q07955) (247 aa) fasta scores: E(): 1.3e-29, 48.117% id in 239 aa	
PFE0860c	hypothetical protein, conserved					
PFE0855c	hypothetical protein, conserved					
PFE0850c	60S ribosomal protein L12, putative				Exon 1 changed to that defined by chr5.glm_185, this is supported by alignments to other orthologues including one in P. yoelli:AEB:17-03-04	<b>attribution</b>:
PFE0845c	60S ribosomal subunit protein L8, putative	structural constituent of ribosome	translation	large ribosomal subunit	Similar to Homo sapiens similar to ribosomal protein l8 TR:AAH12197 (EMBL:BC012197) (257 aa) fasta scores: E(): 1.8e-71, 67.589% id in 253 aa	<b>attribution</b>:
PFE0840c	hypothetical protein, conserved					
PFE0835w	ubiquitin carboxyl-terminal hydrolase 2, putative	ubiquitin-specific protease activity	protein deubiquitination		Similar to Mus musculus ubiquitin carboxyl-terminal hydrolase 4 usp4 or unP SW:UBP4_MOUSE (P35123) (962 aa) fasta scores: E(): 4.3e-30, 30.572% id in 507 aa	<b>attribution</b>:
PFE0830c	hypothetical protein, conserved	translation factor activity, nucleic acid binding	translation	apicoplast, nucleus, plasma membrane	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.881, signal anchor probability 0.100) with cleavage site probability 0.687 between residues 27 and 28	Similar to Plasmodium falciparum mb2 TR:AAK72249 (EMBL:AF378134) (925 aa) fasta scores: E(): 0, 100.000% id in 925 aa
PFE0825w	metabolite drug transporter	transporter activity	transport	integral to membrane	Similar to Mus musculus solute carrier family 22 TR:AAH03734 (EMBL:BC003734) (406 aa) fasta scores: E(): 2.5e-18, 26.720% id in 378 aa	<b>attribution</b>:
PFE0820c	hypothetical protein, conserved				Similar to Saccharomyces cerevisiae hypothetical 32.8 kDa protein plp2 or yor281C TR:Q12017 (EMBL:X89633) (286 aa) fasta scores: E(): 1.4e-06, 28.852% id in 305 aa	
PFE0815w	hypothetical protein, conserved			apicoplast	Weak similarity to several tRNA pseudouridine synthases, incl. Staphylococcus aureus tRNA pseudouridine synthase a truA TR:BAB45147 (EMBL:AP003364) (267 aa) fasta scores: E(): 0.00011, 30.952% id in 126 aa	1 probable transmembrane helix predicted by TMHMM2.0 at aa 5-24
PFE0810c	40S ribosomal subunit protein S14, putative	RNA binding	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	Similar to Arabidopsis thaliana putative 40s ribosomal protein s14 f24k9.19 TR:Q9CAX6 (EMBL:AC008153) (150 aa) fasta scores: E(): 2.9e-44, 81.457% id in 151 aa	<b>attribution</b>:
PFE0805w	cation-transporting ATPase 1	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism, cation transporter activity	cation transport	apicoplast, integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0800w	hypothetical protein, conserved					
PFE0795c	nif-like protein, putative				Similar to Mus musculus nif-like protein nifL TR:CAC69078 (EMBL:AJ344340) (348 aa) fasta scores: E(): 7.1e-16, 36.310% id in 168 aa	Similar to Dictyostelium discoideum development protein Dg1148 dg1148 TR:Q9XYL0 (EMBL:AF111941) (306 aa) fasta scores: E(): 2.6e-16, 37.267% id in 161 aa
PFE0790c	BolA-like protein, conserved				similar to yersinia pestis bola-like protein; py00231; length 84 aa; id=79.76%; ungapped id=79.76%; E()=5e-27; ; 84 aa overlap; query 1-84 aa; subject 1-84 aa, and to E. coli BolA protein. In E. coli over expression of this protein causes a round morphology and may be involved in the swtich between elongation and septation during cell division	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.807, signal anchor probability 0.000) with cleavage site probability 0.263 between residues 21 and 22
PFE0785c	drug/metabolite transporter				10 probable transmembrane helices predicted by TMHMM2.0 at aa 23-45, 55-72, 93-115, 120-142, 149-166, 176-193, 214-236, 246-265, 278-300 and 304-326	Weak similarity to Zea mays triose phosphate/phosphate translocator, chloroplast precursor cpT SW:CPTR_MAIZE (P49133) (409 aa) fasta scores: E(): 0.065, 23.263% id in 331 aa
PFE0780w	hypothetical protein, conserved					
PFE0775c	amino acid transporter				Weak similarity to Plasmodium falciparum predicted amine transporter pfb0435C TR:O96181 (EMBL:AE001394) (1138 aa) fasta scores: E(): 4e-10, 21.853% id in 993 aa	<b>attribution</b>:
PFE0770w	hypothetical protein, conserved					
PFE0765w	phosphatidylinositol 3-kinase, putative	phosphatidylinositol 3-kinase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0760w	hypothetical protein, conserved					
PFE0755c	rhomboid protease, putative				5 probable transmembrane helices predicted by TMHMM2.0 at aa 267-286, 377-394, 404-423, 428-447 and 462-481	C-terminal end of exon I similar to Treponema pallidum glpg putative protein TR:O83947 (EMBL:AE001265) (208 aa) fasta scores: E(): 2.8e-07, 31.818% id in 154 aa
PFE0750c	hypothetical protein, conserved				Similar to Saccharomyces cerevisiae chromosome iv reading frame orf Ydl209C ydl209C TR:Q12046 (EMBL:Z74257) (339 aa) fasta scores: E(): 4.5e-10, 34.061% id in 229 aa putative RNA recognition function	
PFE0745w	hypothetical protein, conserved					
PFE0740c	hypothetical protein, conserved					
PFE0735w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 1526-1548	
PFE0730c	ribose 5-phosphate epimerase, putative	ribose-5-phosphate isomerase activity	pentose-phosphate shunt, non-oxidative branch		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0725c	hypothetical protein, conserved				4 probable transmembrane helices predicted by TMHMM2.0 at aa 32-54, 67-89, 131-153 and 181-198	Signal anchor predicted SignalP 2.0 HMM (Signal peptide probabilty 0.000, signal anchor probability 0.822) with cleavage site probability 0.000 between residues 51 and 52
MAL5_tRNA_Phe1	tRNA Phenylalanine				GAA anticodon, cove score = 82.85	
PFE0715w	asparagine -- tRNA ligase, putative	aspartate-tRNA ligase activity	aspartyl-tRNA aminoacylation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0710w	hypothetical protein, conserved			apicoplast	GPI-Anchor Signal predicted for PFE0710w by DGPI v2.04 with cleavage site probability 2.4940002 near 849	<b>attribution</b>:
PFE0705c	helicase, belonging to UvrD family, putative				1 probable transmembrane helix predicted by TMHMM2.0 at aa 144-166	
PFE0700c	hypothetical protein, conserved				Similar to Homo sapiens hypothetical 44.3 kDa protein TR:Q9UMU0 (EMBL:AL096883) (385 aa) fasta scores: E(): 1.9e-44, 46.693% id in 257 aa	
PFE0695w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 146-163	
PFE0690c	PfRab1a				Rab1a	<b>attribution</b>:
PFE0685w	hypothetical protein, conserved				7 probable transmembrane helices predicted by TMHMM2.0 at aa 12-34, 44-66, 71-93, 98-120,122-144, 149-171 and 178-200	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.021, signal anchor probability 0.978) with cleavage site probability 0.004 between residues 59 and 60
PFE0680w	hypothetical protein, conserved					
PFE0675c	deoxyribodipyrimidine photolyase (photoreactivating enzyme, DNA photolyase), putative	deoxyribodipyrimidine photo-lyase activity	DNA repair		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0670w	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted by TMHMM2.0 at aa 10-27	Signal peptide predicted for MAL5P1.139 by SignalP 2.0 HMM (Signal peptide probabilty 0.932, signal anchor probability 0.049) with cleavage site probability 0.650 between residues 23 and 24
PFE0665c	GTP-binding protein, putative	guanyl nucleotide binding			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0660c	purine nucleotide phosphorylase, putative	uridine phosphorylase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0655w	hypothetical protein, conserved					
PFE0650c	hypothetical protein, conserved					
PFE0645w	hypothetical protein, conserved				Weak similarity to Paramecium tetraurelia probable calcium/calmodulin-binding membrane protein pcm4 gk2.5 TR:Q9XY44 (EMBL:AF050520) (576 aa) fasta scores: E(): 3.2e-06, 27.160% id in 162 aa	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.846, signal anchor probability 0.000) with cleavage site probability 0.805 between residues 19 and 20
PFE0640w	hypothetical protein, conserved					
PFE0635c	hypothetical protein, conserved					
PFE0630c	orotate phosphoribosyltransferase, putative	orotate phosphoribosyltransferase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0625w	Rab1b, GTPase				Similar to Plasmodium falciparum putative gtpase rab1B TR:Q9BHN1 (EMBL:AJ409198) (200 aa) fasta scores: E(): 4e-70, 100.000% id in 200 aa	<b>attribution</b>:
PFE0620c	hypothetical protein, conserved					
PFE0615w	hypothetical protein, conserved					
PFE0610c	CDK-activating kinase assembly factor, putative				Similar to Homo sapiens cdk-activating kinase assembly factor mat1 mnat1 or mat1 or cap35 SW:MAT1_HUMAN (P51948) (309 aa) fasta scores: E(): 8.1e-08, 27.451% id in 204 aa ; also similar to Mus musculus menage a trois 1 mnat1 TR:Q9D8D2 (EMBL:AK008134) (309 aa) fasta scores: E(): 1.6e-08, 28.571% id in 203 aa	<b>attribution</b>:
PFE0605c	glutathione synthetase	ATP binding, glutathione synthase activity	glutathione biosynthetic process, response to oxidative stress		gS	<b>attribution</b>:
PFE0600c	hypothetical protein, conserved					
PFE0595w	hypothetical protein, conserved				Similar to Drosophila melanogaster probable prefoldin subunit 6 cg7770 SW:PFD6_DROME (Q9VW56) (125 aa) fasta scores: E(): 0.0022, 30.000% id in 110 aa	
PFE0590w	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFE0590w by DGPI v2.04, no cleavage site predicted	
PFE0585c	myo-inositol 1-phosphate synthase, putative	inositol-3-phosphate synthase activity	myo-inositol biosynthetic process		Similar to Nicotiana tabacum myo-inositol 1-phosphate synthase TR:Q9LW96 (EMBL:AB009881) (510 aa) fasta scores: E(): 2.3e-54, 42.505% id in 487 aa	<b>attribution</b>:
PFE0580w	hypothetical protein, conserved					
PFE0575c	hypothetical protein, conserved			apicoplast	1 probable transmembrane helix predicted by TMHMM2.0 at aa 180-202	Asparagine-rich
PFE0570w	hypothetical protein, conserved					
PFE0565w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 330-352	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.867, signal anchor probability 0.070) with cleavage site probability 0.277 between residues 24 and 25
PFE0560c	hypothetical protein, conserved			apicoplast		
PFE0555w	stearoyl-CoA desaturase (acyl-CoA desaturase, faty acid desaturase), putative	stearoyl-CoA 9-desaturase activity	fatty acid biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0550w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 4-21	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.844, signal anchor probability 0.000) with cleavage site probability 0.349 between residues 17 and 18
PFE0545c	histamine-releasing factor, putative				Similar to Homo sapiens translationally controlled tumor protein TCTP or histamine releasing factor HRF SW:TCTP_HUMAN (P13693) (172 aa) fasta scores: E(): 5e-14, 34.483% id in 174 aa; also similar to sequence described as Plasmodium yoelii translationally controlled tumor protein tctP TR:Q9XYU2 (EMBL:AF124820) (154 aa) fasta scores: E(): 5.5e-49, 88.312% id in 154 aa	
PFE0543c	hypothetical protein				annotation change, aeb, 110405, new gene model defined after TBLASTX coparison to P. knowlesi	
PFE0540w	WD-repeat potein, putative	protein binding			Similar to Chlamydomonas reinhardtii flagellar WD-repeat protein Pf20 SW:PF20_CHLRE (P93107) (606 aa) fasta scores: E(): 7.5e-37, 31.622% id in 487 aa	
PFE0535w	hypothetical protein, conserved					
PFE0530w	hypothetical protein, conserved					
MAL5_tRNA_Leu1	tRNA Leucine				 anticodon TAG, cove score =74.8	
PFE0520c	topoisomerase I	DNA topoisomerase type I activity	DNA topological change		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0515w	hypothetical protein, conserved					
PFE0510c	hypothetical protein, conserved					
PFE0505w	cyclophilin, putative	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding		Residues implicated in PPIase activity and cyclosporin A-binding are present; sequence includes large N-terminal extension	
PFE0500c	hypothetical protein, conserved				Low complexity. Similar to Plasmodium falciparum Pfc0425W protein pfc0425W TR:O77336 (EMBL:Z98547) (4550 aa) fasta scores: E(): 3.4e-40, 23.626% id in 2565 aa	
PFE0495w	hypothetical protein, conserved			apicoplast		
PFE0490w	hypothetical protein, conserved					
PFE0485w	phosphatidylinositol 4-kinase, putative	1-phosphatidylinositol 4-kinase activity	phosphorylation, signal transduction		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0480c	hypothetical protein, conserved			apicoplast		
PFE0475w	asparagine -- t RNA ligase, putative	asparagine-tRNA ligase activity	translation	apicoplast	Similar to Plasmodium falciparum asparaginyl-tRNA synthetase pfb0525W TR:O96198 (EMBL:AE001400) (610 aa) fasta scores: E(): 1.9e-55, 35.139% id in 646 aa	<b>attribution</b>:
PFE0470w	hypothetical protein, conserved					
PFE0465c	RNA polymerase I	DNA-directed RNA polymerase activity	transcription from RNA polymerase I promoter	DNA-directed RNA polymerase I complex	Similar to Plasmodium falciparum RNA polymerase i TR:Q26008 (EMBL:L11172) (2910 aa) fasta scores: E(): 0, 98.970% id in 2913 aa	<b>attribution</b>:
PFE0460c	hypothetical protein, conserved					
PFE0455w	phosphatase 1 regulatory subunit, putative	protein phosphatase type 1 regulator activity		apicoplast	Similar to Mus musculus protein phosphatase 1, regulatory TR:AAH13524 (EMBL:BC013524) (361 aa) fasta scores: E(): 3.4e-08, 32.000% id in 250 aa	
PFE0450w	chromosome condensation protein, putative				Similar to Arabidopsis thaliana chromosome condensation protein TR:Q9FJL0 (EMBL:AB015468) (1241 aa) fasta scores: E(): 1.4e-27, 27.682% id (37.354% ungapped) in 1622 aa overlap (57-1667:18-1230)	
PFE0445c	SNAP protein (soluble N-ethylmaleimide-sensitive factor Attachment Protein), putative	intracellular transporter activity, soluble NSF attachment protein activity		Golgi apparatus, endoplasmic reticulum	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0440w	hypothetical protein, conserved				Weak similarity to Plasmodium falciparum Pfc0425W protein pfc0425W TR:O77336 (EMBL:Z98547) (4550 aa) fasta scores: E(): 7.2e-23, 22.792% id in 3238 aa	
PFE0435c	single-strand binding protein, putative	single-stranded DNA binding		apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0430w	ATP-dependent RNA helicase, putative	ATP-dependent RNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0425w	hypothetical protein, conserved				Weakly similar to Arabidopsis thaliana F8n16.20 protein f8n16.20 TR:Q9ZV23 (EMBL:AC005727) (332 aa) fasta scores: E(): 2e-12, 28.763% id in 299 aa	
PFE0420c	guanidine nucleotide exchange factor, putative	Ran guanyl-nucleotide exchange factor activity	DNA packaging	apicoplast, nucleus	Similar to Plasmodium falciparum guanidine nucleotide exchange factor pfrcc1 (1327 aa) fasta scores: E(): 9.6e-190, 97.459% id in 1338 aa factor	<b>attribution</b>:
PFE0415w	transcription factor iib, putative	general RNA polymerase II transcription factor activity	transcription from RNA polymerase II promoter	transcription factor TFIIIB complex	Similar to Homo sapiens transcription factor iib TR:Q9Y6A4 (EMBL:AF093680) (193 aa) fasta scores: E(): 5.4e-24, 46.354% id in 192 aa	<b>attribution</b>:
PFE0410w	triose or hexose phosphate / phosphate translocator, putative	glucose 6-phosphate:phosphate antiporter activity		apicoplast, membrane	Similar to Pisum sativum triose phosphate/phosphate translocator, chloroplast precursor SW:CPTR_PEA (P21727) (402 aa) fasta scores: E(): 1.4e-35, 36.012% id in 336 aa	Highest similarity to triose phosphate/ phosphate translocator; also similar to hexose phosphate/ phosphate translocator; no leader sequence.
PFE0405c	hypothetical protein, conserved			apicoplast	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.675, signal anchorprobability 0.312) with cleavage site probability 0.348 between residues 24 and 25	annotation change, aeb, 121104, gene model modified. Intron defined in exon2.
PFE0400w	hypothetical protein, conserved				Weak similarity to Saccharomyces cerevisiae hypothetical 123.6 kDa protein in por2-cox5b intergenic region yil112W SW:YIL2_YEAST (P40480) (1083 aa) fasta scores: E(): 2.8e-05, 24.011% id in 379 aa	
PFE0395c	hypothetical protein, conserved				GPI-Anchor Signal predicted for PFE0395c by DGPI v2.04 with cleavage site probability 0.344 near 328	1 probable transmembrane helix predicted by TMHMM2.0 at aa 328-347
PFE0390w	hypothetical protein, conserved					
PFE0385w	hypothetical protein, conserved				Weak similarity to Plasmodium falciparum Pfc0760C protein pfc0760C TR:O77384 (EMBL:Z98551) (3394 aa) fasta scores: E(): 2.3e-27, 24.341% id in 1290 aa	
PFE0380c	hypothetical protein, conserved				Similar to Caenorhabditis elegans coded for by c. elegans cdna yk53d12.5 f59e12.5 TR:O01894 (EMBL:AF003386) (527 aa) fasta scores: E(): 1.7e-10, 27.019% id in 359 aa	
PFE0375w	cell differentiation protein rcd1, putative		cell differentiation		Asparagine-rich protein; ProfileScan hit to PS50321, Asparagine-rich region rcd1	Similar to Schizosaccharomyces pombe cell differentiation protein rcd1 or spac29b12.06C TR:Q92368 (EMBL:D87956) (283 aa) fasta scores: E(): 3.6e-57, 66.547% id in 278 aa
PFE0370c	subtilisin-like protease precursor, putative	subtilase activity	proteolysis		Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.894, signal anchor probability 0.106) with cleavage site probability 0.818 between residues 25 and 26 precursor	Similar to Plasmodium falciparum subtilisin-like protease precursor sub-1 or pfsub-1 TR:O61142 (EMBL:AJ002594) (690 aa) fasta scores: E(): 0, 99.710% id in 690 aa
PFE0365c	hypothetical protein, conserved					
PFE0360c	hypothetical protein, conserved				Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.028, signal anchor probability 0.924) with cleavage site probability 0.009 between residues 22 and 23	
PFE0355c	serine protease belonging to subtilisin family, putative	subtilase activity	proteolysis	apicoplast	Similar to Plasmodium falciparum subtilisin-like protease precursor sub-1 or pfsub-1 TR:O61142 (EMBL:AJ002594) (690 aa) fasta scores: E(): 1.1e-23, 26.418% id in 723 aa subtilisin family	<b>attribution</b>:
PFE0350c	60S ribosomal subunit protein L4/L1, putative	RNA binding, structural constituent of ribosome	translation	large ribosomal subunit	Similar to Rattus norvegicus 60S ribosomal protein l4 rpl4 or rpl1 SW:RL4_RAT (P50878) (421 aa) fasta scores: E(): 1.2e-69, 49.754% id in 406 aa	Gene model modified and verified, using data from the proteomics study, lead by M. Mann and Henk Stunnenberg L4/L1
PFE0345c	hypothetical protein, conserved			apicoplast		
PFE0340c	rhomboid protease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0335w	hypothetical protein, conserved					
PFE0330w	hypothetical protein, conserved				Contains SMART TBC domain (SM0164). Widespread domain present in Gyp6 and Gyp7, possibly could act as a GTP-activator activator function	
PFE0328w	hypothetical protein, conserved, pseudogene				annotation change, aeb, 12-11-04, new gene model defined, low similarity scores observed to histone deacetylase.	This hypothetical pseudogene was identified by TBlastX hits within regions of conserved synteny with P knowlesi
PFE0325w	hypothetical protein, conserved				Asparagine-rich	
PFE0320w	hypothetical protein				1 probable transmembrane helix predicted by TMHMM2.0 at aa 966-988	
PFE0315c	hypothetical protein				1 probable transmembrane helix predicted by TMHMM2.0 at aa 9-31	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.386, signal anchor probability 0.613) with cleavage site probability 0.269 between residues 30 and 31
PFE0310c	hypothetical protein, conserved				Low complexity; Weak similarity to Plasmodium falciparum protein with DNAJ domain pfb0925W TR:O96277 (EMBL:AE001426) (657 aa) fasta scores: E(): 3e-07, 27.891% id in 294 aa	
PFE0305w	transcription initiation factor TFiid, TATA-binding protein	general RNA polymerase II transcription factor activity	transcription from RNA polymerase II promoter	transcription factor TFIID complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0300c	60S ribosomal subunit protein L24, putative	structural constituent of ribosome	translation	large ribosomal subunit	Similar to Homo sapiens rpl24 TR:AAK26249 (EMBL:AF212226) (163 aa) fasta scores: E(): 3.6e-26, 49.689% id in 161 aa L24	<b>attribution</b>:
PFE0295w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 15-37	
PFE0290c	hypothetical protein, conserved					
PFE0285c	ubiquitin-like protein, putative		modification-dependent protein catabolic process, protein ubiquitination during ubiquitin-dependent protein catabolic process, ubiquitin cycle		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0280c	hypothetical protein, conserved				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.881, signal anchor probability 0.000) with cleavage site probability 0.840 between residues 21 and 22	4 probable transmembrane helices predicted for by TMHMM2.0 at aa 515-534, 547-566, 652-674 and 686-708
PFE0275w	hypothetical protein, conserved					
PFE0270c	DNA repair protein, putative	damaged DNA binding	DNA repair		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0265c	hypothetical protein, conserved			apicoplast	Weak similarity to Plasmodium falciparum hypothetical 118.9 kDa protein pfb0765W TR:O96246 (EMBL:AE001417) (980 aa) fasta scores: E(): 8.8e-06, 22.076% id in 684 aa	Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.848, signal anchor probability 0.009) with cleavage site probability 0.489 between residues 15 and 16
PFE0260w	UDP-N-acetyl glucosamine:UMP antiporter				9 probable transmembrane helices predicted by TMHMM2.0 at aa 64-86, 101-118, 142-164,174-191, 411-433, 443-462, 534-556, 561-583 and 590-608	<b>attribution</b>:
PFE0255w	actin-related protein, putative	structural constituent of cytoskeleton	cytoskeleton organization and biogenesis	actin cytoskeleton	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0250w	hypothetical protein, conserved				Asparagine-rich	
PFE0245c	hypothetical protein, conserved				4 probable transmembrane helices predicted by TMHMM2.0 at aa 1223-1241, 1262-1281, 2835-2857 and 2897-2919	Conserved low complexity repeats with other plasmodium genes
PFE0240w	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 20-42	
PFE0240c	hypothetical protein, conserved				Similar to Plasmodium falciparum PFC0425W protein PFC0425W TR:O77336 (EMBL:Z98547) (4550 aa) fasta scores: E(): 1.5e-22, 21.644% id in 4477 aa. Revised: extra codons added to 3' end	
PFE0230w	hypothetical protein, conserved					
PFE0225w	3-methyl-2-oxobutanoate dehydrogenase (lipoamide), putative	3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity	tricarboxylic acid cycle	tricarboxylic acid cycle enzyme complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0220w	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0215w	ATP-dependent helicase, putative	ATP-dependent helicase activity		apicoplast	Similar to Arabidopsis thaliana RNA helicase TR:Q9LVB7 (EMBL:AB019235) (671 aa) fasta scores: E(): 3.9e-48, 35.566% id in 627 aa	<b>attribution</b>:
PFE0210c	hypothetical protein, conserved					
PFE0205w	ATP-dependent helicase, putative	ATP-dependent helicase activity		apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0200c	hypothetical protein, conserved				Similar to Arabidopsis thaliana putative zinc finger protein pmZ TR:Q9XH76 (EMBL:AF139098) (186 aa) fasta scores: E(): 1.7e-12, 37.500% id in 136 aa	
PFE0195w	cation transporting P-ATPase	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism, cation transporter activity	cation transport	membrane	PfATPase3	<b>attribution</b>:
PFE0190c	hypothetical protein, conserved				1 probable transmembrane helix predicted by TMHMM2.0 at aa 16-35	
PFE0185c	60S ribosomal subunit protein L31, putative	structural constituent of ribosome	translation	large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0180w	hypothetical protein			apicoplast		
PFE0175c	unconventional myosin pfm-b	ATP binding, actin binding		myosin complex	Similar to Plasmodium falciparum unconventional myosin pfm-b TR:Q9U3U9 (EMBL:AF222716) (801 aa) fasta scores: E(): 0, 99.376% id in 801 aa	<b>attribution</b>:
PFE0170c	protein kinase, putative	protein kinase activity	protein amino acid phosphorylation		Similar to Drosophila melanogaster Cg1973 protein cg1973 TR:Q9VAH7 (EMBL:AE003771) (873 aa) fasta scores: E(): 5.1e-16, 23.553% id in 743 aa	
PFE0165w	actin depolymerizing factor, putative	actin binding	actin filament depolymerization		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0160c	Ser/Arg-rich splicing factor, putative	nucleic acid binding	RNA splicing	spliceosome	Similar to Homo sapiens tls-associated serine-arginine protein 2 TR:AAH05039 (EMBL:BC005039) (262 aa) fasta scores: E(): 1.7e-14, 33.835% id in 266 aa	Similar to Oryzias latipes splicing factor arginine/serine rich 2 sfrs2 TR:Q9DGK5 (EMBL:AF288041) (211 aa) fasta scores: E(): 5.2e-14, 37.190% id (42.857% ungapped) in 242 aa overlap (13-253:1-211); match to SMART:RRN (RNA recognition motif) at position 13-86, E-value = 1.4e-22
PFE0155w	hypothetical protein, conserved				Asparagine-rich	
PFE0150c	4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK), putative	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity	isoprenoid biosynthetic process	apicoplast	Signal anchor predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.155, signal anchor probability 0.661) with cleavage site probability 0.051 between residues 27 and 28	1 probable transmembrane helix predicted by TMHMM2.0 at aa 7-26
PFE0145w	50S ribosomal subunit protein L28, putative	structural constituent of ribosome	translation	apicoplast, large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0140c	hypothetical protein, conserved				Weak similarity to mitochondrial import inner membrane translocase subunit from several organism; e.g. similar to Saccharomyces cerevisiae mitochondrial import inner membrane translocase subunit tim10 mrs11 or tim10 or yhr005c-a or yhr005bC SW:IM10_YEAST (P87108) (93 aa) fasta scores: E(): 0.00046, 26.506% id in 83 aa	
PFE0135w	hypothetical protein, conserved					
PFE0130c	hypothetical protein, conserved				Asparagine-rich	
PFE0125w	hypothetical protein, conserved				2 probable transmembrane helices predicted by TMHMM2.0 at aa 450-472 and 567-589	<b>attribution</b>:
PFE0120c	Merozoite Surface Protein 8, MSP8			membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0115c	hypothetical protein, conserved			apicoplast		
PFE0110w	hypothetical protein, conserved				5 probable transmembrane helices predicted for by TMHMM2.0 at aa 276-298, 319-341, 356-378, 398-415 and 419-441	Weak similarity to Arabidopsis thaliana putative 22 kDa peroxisomal membrane protein t26i20.2 TR:O82324 (EMBL:AC005396) (252 aa) fasta scores: E(): 2.5e-07, 25.628% id in 199 aa
PFE0105c	hypothetical protein, conserved					
PFE0100w	hypothetical protein, conserved			apicoplast	Weak similarity to Amsacta moorei entomopoxvirus Amv156 TR:Q9EMP3 (EMBL:AF250284) (1238 aa) fasta scores: E(): 1.4e-13, 22.034% id in 1298 aa	
PFE0095c	hypothetical protein, conserved					
PFE0090w	hypothetical protein, conserved				Weak similarity to Plasmodium falciparum pfc0150w, mal3p1.12 protein TR:O77317 (EMBL:Z97348) (1156 aa) fasta scores: E(): 8e-13, 23.077% id in 598 aa	
PFE0085c	hypothetical protein, conserved				Weak similarity to Drosophila melanogaster protein cdc27 or cg8610 TR:Q9VS37 (EMBL:AE003559) (900 aa) fasta scores: E(): 7.4e-07, 21.600% id in 375 aa	
PFE0080c	rhoptry-associated protein 2, RAP2			rhoptry	RAP-2	RAP2
PFE0075c	rhoptry-associated protein 3, RAP3			rhoptry	RAP3,RAP-3	Located adjacent to RAP2 and shows some similarity with it. Encodes a 40KDa protein(37KDa has also been reported) that has been observed to cooprecipitate with RAP1 and RAP2. Its expression coincides with that of RAP1 and RAP2, which is during schizogeny and it can also be detected in ring-stage parasites after erythrocyte invasion (PMID: 1698657)(PMID: 6391219). Targeted gene disruption experiments have demonstrated that RAP3 is not essential for parasite survival. Loss of RAP3 had no effect on parasite growth or on trafficking of RAP1 and RAP2 into rhoptry organelles. It is possible that loss of RAP3 can be complemented by RAP2 (PMID: 12183575).; Homologues of RAP2 and RAP3 have been characterised in P. yoelii, P. berghei, P. vivax, and P. knowlesi. In the species RAP2 and RAP3 are encoded in a single open reading frame, perhaps suggesting that RAP2 and RAP3 evolved from a gene duplication event in falciparum, or conversely a gene fusion event in these species. The signal peptide cleavage site and 3 of 5 cysteine residues are conserved (PMID: 12183575)
PFE0070w	interspersed repeat antigen, putative				Similar to Plasmodium falciparum interspersed repeat antigen TR:Q25884 (EMBL:M17877) (700 aa) fasta scores: E(): 7.5e-89, 75.000% id in 828 aa	
PFE0065w	skeleton binding protein1, PfSBP1			Maurer's cleft	Similar to Plasmodium falciparum skeleton binding protein 1 sbp1 TR:Q9NFF5 (EMBL:AJ387723) (338 aa) fasta scores: E(): 3.2e-88, 95.107% id (96.285% ungapped) in 327 aa overlap (1-323:1-327)	1 probable transmembrane helix predicted for by TMHMM2.0 at aa 216-238
PFE0060w	hypothetical protein				Signal peptide predicted by SignalP 2.0 HMM (Signal peptide probabilty 0.989, signal anchor probability 0.000) with cleavage site probability 0.564 between residues 23 and 24	3 probable transmembrane helices predicted for by TMHMM2.0 at aa 4-21, 357-379 and 389-407
PFE0055c	heat shock protein, putative	unfolded protein binding		apicoplast, membrane	1 probable transmembrane helix predicted for by TMHMM2.0 at aa 13-32	Similar to Arabidopsis thaliana putative heat shock protein f23h11.4 TR:Q9XIF5 (EMBL:AC007258) (331 aa) fasta scores: E(): 7e-41, 41.463% id (43.038% ungapped) in 328 aa overlap (80-398:4-328); also similar to Plasmodium falciparum protein with DNAJ domain, dnj1/sis1 family pfb0595W TR:O96212 (EMBL:AE001405) (328 aa) fasta scores: E(): 2.5e-79, 60.802% id (61.180% ungapped) in 324 aa overlap (80-401:4-327)
PFE0050w	hypothetical protein				1 probable transmembrane helix predicted for by TMHMM2.0 at aa 44-61	
PFE0045c	kinase, putative	protein kinase activity	protein amino acid phosphorylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0040c	Mature parasite-infected erythrocyte surface antigen (MESA) or PfEMP2				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PFE0035c	RIF pseudogene, RIFIN pseudogene				RIF, degenerate	RIF fragment
PFE0030c	stevor pseudogene	molecular_function	biological_process	Maurer's cleft, membrane	stevor, degenerate	Apparent single frameshift in exon II
PFE0025c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	Similar to Plasmodium falciparum rifin pfb1005W TR:O96288 (EMBL:AE001432) (316 aa) fasta scores: E(): 8.3e-52, 54.574% id in 317 aa	RIF
PFE0020c	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	1 probable transmembrane helix predicted for by TMHMM2.0 at aa 332-354
PFE0015c	RIF pseudogene, RIFIN pseudogene				RIF, degenerate	Similar to Plasmodium falciparum rifin pfb1040W TR:O96293 (EMBL:AE001433) (345 aa) fasta scores: E(): 1.1e-50, 53.161% id in 348 aa. Contains nonsense mutations at apparent start position for exon 2
PFE0010c	erythrocyte membrane protein 1 (PfEMP1) pseudogene				VAR pseudogene	VAR fragment
PFE0005w	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	<b>attribution</b>:
MAL8P1.330	hypothetical protein, conserved in P.falciparum				annotation change, aeb, (141204), gene model defined with aid of SNAP gene prediction, new gene model	
MAL8P1.335	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.220	erythrocyte membrane protein 1 (PfEMP1)				PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	VAR
MAL8P1.219	rifin				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	RIF
MAL8P1.218	rifin				RIF	annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model
MAL8P1.217	stevor				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.216	rifin				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.215	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.214	Stever pseudogene, putative				annotation change, aeb, (011104) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.213	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.320	hypothetical protein, conserved in P.falciparum				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.212	RESA-like pseudogene				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	annotation change, aeb, 301104; new gene model defined
MAL8P1.211	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.210	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.209	VAR-like protein				annotation change, aeb, 30112004, gene model defined	annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model
MAL8P1.208	rifin				RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
MAL8P1.207	erythrocyte membrane protein 1, PfEMP1				VAR	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)
MAL8P1.206	hypothetical protein, conserved in P. falciparum				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.205	hypothetical protein				annotation change, aeb, 301104; new gene model defined on new chromosome assembly	
MAL8P1.204	DnaJ protein, putative				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	weak similarity to hypothetical protein PF08_0115, length 675 aa, id=40.96%
MAL8P1.1	surface-associated interspersed gene 8.1, (SURFIN8.1)				also has similarity to hypothetical protein PF14_0747; length 1994 aa; id=69.4%; and hypothetical protein PFA0725w, length=1980; id=69.4%	3D7Surf8.1
MAL8P1.2	hypothetical protein, conserved in P.falciparum					
PF08_0001	hypothetical protein			apicoplast	2255.m00020	
PF08_0002	surface-associated interspersed gene 8.2 (SURFIN8.2)				3D7Surf8.2	
MAL8P1.3	integral membrane protein, conserved in P. falciparum			integral to membrane		
MAL8P1.4	hypothetical protein, conserved					
PF08_0003	tryptophan/threonine-rich antigen					
PF08_0004	hypothetical protein, conserved			apicoplast		
PF08_0005	hypothetical protein, conserved					
MAL8P1.310	putative senescence-associated protein				annotation change, aeb, (311004) gene model defined after SNAP analysis and comparison with P. yoelii, new gene model	
PF08_tmp1					28s rRNA not part of a normal rRNA operon	
MAL8a_5.8s					5.8S ribosomal RNA not part of a normal rRNA operon	
MAL8P1.6	early transcribed membrane protein 8, ETRAMP 8				ETRAMP8	Gene model formerly consisted of two exons. Characterisation of the ETRAMP gene family showed that this was incorrect, table 1 (PMID:12686607)
MAL8P1.7	hypothetical protein					
MAL8P1.8	hypothetical protein, conserved					
MAL8P1.9	u6 snRNA-associated sm-like protein, putative	U6 snRNA binding	nuclear mRNA splicing, via spliceosome	small nucleolar ribonucleoprotein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0006	prohibitin, putative	molecular_function	regulation of cell proliferation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.10	hypothetical protein, conserved				annotation change, aeb, 141204; gene model revised after SNAP analysis, exon4 truncated to a more convincing splice donor	
MAL8P1.11	hypothetical membrane protein, conserved				annotation change, aeb, 151104; Gene model modified, intron added in exon2, exon 3 added. Note this gene model will be added to PlasmoDB in the next sheduled update. Alternative gene predictions and expression data are displayed in PlasmoDB	
PF08_0007	hypothetical protein, conserved					
PF08_0008	hypothetical protein, conserved				GPI-Anchor Signal predicted for PF08_0008 by DGPI v2.04 with cleavage site probability 0.2924 near 715	<b>attribution</b>:
MAL8P1.12	hypothetical protein, conserved					
MAL8P1.13	integral membrane protein, conserved	molecular_function	biological_process	integral to membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0009	translation initiation factor EIF-2b alpha subunit, putative	translation initiation factor activity	translational initiation	eukaryotic translation initiation factor 2B complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.14	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0010	hypothetical protein, conserved					
PF08_0011	leucine - tRNA ligase	leucine-tRNA ligase activity	leucyl-tRNA aminoacylation, translation	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.15	hypothetical protein, conserved					
MAL8P1.16	rhomboid protease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.17	disulfide isomerase precursor, putative	protein disulfide isomerase activity	protein folding	endoplasmic reticulum lumen	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0012	SET domain protein, putative					
PF08_0013	hypothetical membrane protein, conserved					
MAL8P1.18	hypothetical protein, conserved			apicoplast		
PF08_0014	plastid 50S ribosomal protein, putative	structural constituent of ribosome	translation	apicoplast, plastid large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0015	hypothetical protein, conserved			apicoplast		
PF08_0016	hypothetical protein, conserved			apicoplast		
PF08_0017	hypothetical protein, conserved					
PF08_0018	translation initiation factor-like protein	translation initiation factor activity	translational initiation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.19	RNA helicase, putative			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.20	hypothetical protein, conserved					
PF08_0019	receptor for activated C kinase homolog, PfRACK	protein kinase C binding	G-protein coupled receptor protein signaling pathway	heterotrimeric G-protein complex		
MAL8P1.21	SNARE protein					
PF08_0020	Ubiquitination-mediated degradation component, putative					
MAL8P1.22	dehydrodolichyl diphosphate synthetase, putative	prenyltransferase activity	dolichol biosynthetic process			
PF08_0021	hypothetical protein, conserved					
PF08_0022	hypothetical protein, conserved					
MAL8P1.23	ubiquitin-protein ligase 1, putative	ubiquitin-protein ligase activity	ubiquitin-dependent protein catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.24	hypothetical protein, conserved					
PF08_0023	hypothetical protein, conserved					
MAL8P1.25	hypothetical protein, conserved			apicoplast		
PF08_0024	hypothetical protein, conserved					
PF08_0025	hypothetical protein, conserved					
PF08_0026	hypothetical protein, conserved					
MAL8P1.25a	hypothetical protein, conserved					
MAL8P1.26	hypothetical protein, conserved			apicoplast		
MAL8P1.27	hypothetical protein, conserved					
MAL8P1.28	hypothetical protein, conserved					
MAL8P1.29	hypothetical protein, conserved				annotation change, aeb, 151104; Gene model modified, exon 2 added on the basis of synteny with P knowlesi and P. yoelii. Note this gene model may not be in PlasmoDB but will be added in the next scheduled update	
PF08_0027	hypothetical protein, conserved					
PF08_0028	hypothetical protein, conserved					
MAL8P1.30	hypothetical membrane protein, conserved					
MAL8P1.31	hypothetical protein, conserved					
PF08_0029	hypothetical protein, conserved					
MAL8P1.32	nucleoside transporter, putative	nucleoside transporter activity	nucleoside transport	membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.33	GTP-binding protein, putative	GTP binding				
MAL8P1.34	hypothetical protein, conserved					
MAL8P1.35	exonuclease, putative	molecular_function	biological_process	cellular_component		
PF08_0030	hypothetical protein, conserved					
PF08_0031	oxoglutarate/malate translocator protein, putative	dicarboxylic acid transporter activity, oxoglutarate:malate antiporter activity	alpha-ketoglutarate transport, dicarboxylic acid transport, malate transport, mitochondrial transport	mitochondrial inner membrane	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0032	DnaJ protein, putative					
MAL8P1.36	hypothetical protein, conserved					
MAL8P1.37	lipoate-protein ligase, putative	lipoate-protein ligase activity	lipoate biosynthetic process	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0033	hypothetical protein, conserved					
MAL8P1.38	hypothetical protein, conserved					
PF08_0034	histone acetyltransferase Gcn5, putative	histone acetyltransferase activity	regulation of transcription, DNA-dependent		gcn5	
MAL8P1.40	RNA-binding protein, putative	RNA binding	regulation of translation			
MAL8P1.41	RWD domain-containing protein, putative					
MAL8P1.42	hypothetical protein, conserved					
PF08_0035	hypothetical protein, conserved					
MAL8P1.43	u5 snrnp-specific protein, putative	RNA splicing factor activity, transesterification mechanism		small nucleolar ribonucleoprotein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.44	hypothetical protein					
MAL8P1.45	hypothetical protein, conserved			apicoplast		
PF08_0036	Pfsec23		ER to Golgi vesicle-mediated transport		Pfsec23	<b>attribution</b>:
MAL8P1.46	outer arm dynein light chain 2	motor activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.47	hypothetical protein, conserved				annotation change, aeb, 1701005, gene model modified. Exon3 truncated resulting in the loss of 18 amino acids from the predicted protein sequence	
MAL8P1.48	small nuclear ribonucleoprotein, putative	RNA splicing factor activity, transesterification mechanism		small nucleolar ribonucleoprotein complex		
MAL8P1.49	hypothetical membrane protein, conserved				annotation change, aeb, 151204, gene model modified. Intron defined in former exon1, resulting in the loss of 106 amino acids from the predicted protein sequence	
PF08_0037	hypothetical protein, conserved					
PF08_0038	hypothetical protein, conserved					
MAL8P1.50	hypothetical protein, conserved				Alternative gene model possible	
MAL8P1.51	protein-transport protein sec61 beta 1 subunit, putative	protein transporter activity	intracellular protein transport	translocon complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0039	ribosomal protein, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0040	hypothetical protein, conserved					
PF08_0041	ribosome biogenesis protein nep1 homologue, putative		ribosome biogenesis and assembly		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.52	hypothetical protein, conserved				Alternative gene model possible	
PF08_0042	ATP-dependent RNA helicase prh1, putative	ATP-dependent RNA helicase activity				
PF08_0043	hypothetical protein, conserved					
PF08_0044	Plasmodium falciparum protein kinase 1	protein serine/threonine kinase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.53	hypothetical protein, conserved					
MAL8P1.54	hypothetical protein, conserved					
MAL8P1.55	hypothetical protein, conserved			apicoplast		
PF08_0045	2-oxoglutarate dehydrogenase e1 component	oxoglutarate dehydrogenase (succinyl-transferring) activity	2-oxoglutarate metabolic process, tricarboxylic acid cycle	mitochondrial matrix	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.56	hypothetical protein, conserved					
MAL8P1.57	C-13 antigen	molecular_function	biological_process			
PF08_0046	hypothetical protein, conserved					
PF08_0047	hypothetical protein, conserved			apicoplast		
MAL8P1.58	phosphatidylglycerophosphate synthase	CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity	glycerol-3-phosphate metabolic process, phosphatidylglycerol biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.59	hypothetical protein, conserved			apicoplast		
PF08_0048	ATP-dependent helicase, putative	ATP binding, ATP-dependent helicase activity				
PF08_0049	ribonucleoprotein, putative	RNA splicing factor activity, transesterification mechanism	RNA splicing	small nucleolar ribonucleoprotein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.60	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.61	hypothetical protein, conserved			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.62	hypothetical protein, conserved in other Plasmodium species				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.63	hypothetical protein, conserved			membrane	annotation change, aeb, 151204; gene model modified after SNAP gene prediction analysis. Exon 6 truncated (VNSDLIK), exons 7, 8 and the interstitial region fused resulting in addition of 7 aa (VYSEVIFCSAFEQ), exon12 truncated by 43 aa VREKIKKIKKINEYIYIYKYIYTYFYFYLYFSMVTNLSGLLFI), exons 13 and 14 added	
PF08_0050	MAC/perforin, putative					
PF08_0051	hypothetical protein, conserved					
PF08_0052	hypothetical protein, conserved				GPI-Anchor Signal predicted for PF08_0052 by DGPI v2.04, no cleavage site predicted	GPI-Anchor Signal predicted for PF08_0052 by DGPI v2.04, no cleavage site predicted
PF08_0053	BRIX domain, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.64	hypothetical protein, conserved					
PF08_0054	heat shock 70 kDa protein		response to heat, response to unfolded protein		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0055	u3 small nucleolar ribonucleoprotein protein		RNA processing	small nucleolar ribonucleoprotein complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.65	DNA helicase, putative					
MAL8P1.66	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified on the basis of comparison of exon organisation between P. falciparum, P. knowlesi, and P. yoelii, with the aid of the SNAP gene prediction algorithm resulting in the loss of 26 amino acids from the predicted protein sequence	annotation change, aeb, 170105, gene model modified on the basis of comparison of exon organisation between P. falciparum, P. knowlesi, and P. yoelii, with the aid of the SNAP gene prediction algorithm resulting in the loss of 26 amino acids from the predicted protein sequence
PF08_0056	zinc finger protein, putative	zinc ion binding	biological_process	cellular_component		
MAL8P1.67	hypothetical protein, conserved					
MAL8P1.68	hypothetical protein, conserved					
MAL8P1.69	14-3-3 protein homologue, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.70	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.71	hypothetical protein, conserved				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.72	high mobility group protein, putative	DNA binding	regulation of transcription from RNA polymerase III promoter			
PF08_0057	hypothetical protein, conserved					
MAL8P1.73	hypothetical protein, conserved			apicoplast	annotation change, aeb, 170105, gene model modified on the basis of the SNAP gene prediction algorithm and comparison on regions of conserved synteny between P. falciparum, P. knowlesi and P. yoelii	
PF08_0058	hypothetical protein, conserved					
PF08_0059	protein kinase c inhibitor-like protein, putative	protein kinase C inhibitor activity				
MAL8P1.74	hypothetical protein, conserved					
PF08_0060	asparagine-rich antigen	molecular_function	biological_process	cellular_component		
PF08_0061	hypothetical protein, conserved					
MAL8P1.75a	GTPase, putative				this gene use to be exon 2 of MALP1.75	
MAL8P1.75	Ubiquitin-activating enzyme, putative				this gene used to be a two-exon model, the second exon is now a separate gene with the systematic_id MAL8P1.75a	
PF08_0062	Adenylate kinase					
MAL8P1.76	meiotic recombination protein dmc1-like protein		meiotic recombination	condensed nuclear chromosome	annotation change, aeb, 140405, coordinates of exon 3 modified after an incorrect splice site in the previous model was identified	
MAL8P1.77	hypothetical protein, conserved					
PF08_0063	ClpB protein, putative			apicoplast		
MAL8P1.78	small heat shock protein, putative		response to heat, response to unfolded protein			
MAL8P1.79	hypothetical protein, conserved					
MAL8P1.80	hypothetical protein, conserved				annotation change, aeb, 211204; gene model modified on the basis of comparison on regions of conserved synteny between P. falciparum, P. yoelii and P. knowlesi, and with the aid of the SNAP gene prediction algorithm. Resulting in the loss one exon and 52 amino acids from the gene model.	
PF08_0064	hypothetical protein, conserved					
MAL8P1.81	flavoprotein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0065	WD repeat protein, putative					
PF08_0066	lipoamide dehydrogenase, putative	dihydrolipoyl dehydrogenase activity	acetyl-CoA biosynthetic process from pyruvate	apicoplast, pyruvate dehydrogenase complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.82	hypothetical protein, conserved					
PF08_0067	hypothetical protein, conserved			apicoplast		
MAL8P1.83	eukaryotictranslation initiation factor, putative	translation initiation factor activity	translation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.84	hypothetical protein, conserved					
MAL8P1.85	hypothetical protein, conserved					
PF08_0068	hypothetical protein, conserved					
PF08_0069	importin beta, putative	nuclear localization sequence binding	NLS-bearing substrate import into nucleus	nuclear pore	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0070	RAP protein, putative					
MAL8P1.86	hypothetical protein, conserved			apicoplast	This gene model was formerly annotated with a 60 bp intron located at 711615 to 711676 due to the presence of a TGA stop codon at 707918..707920. This region is now beleived to be translated since this codon is recognised by a selenocysteine charged t-RNA (tRNA [Ser]Ser). This stop codon is preserved across Plasmodium genomes. The observation that donor and acceptor splice sites at this location are not detected outside falciparum is circumstntial evidence supporting the hypothesis that this region is translated. The Plasmodium falciparum 3D7 genome also encodes a putative selenocysteine-specific elongation factor (PFA0495c) and putative selenophosphate synthetase (PFI0505)(PMID:15659334).; SECIS (Selenoysteine Insertion Sequence), a 70 bp regulatory mediating the insertion of selenocysteine has been identified 134 bp downstream of this gene. SECIS elements have been defined in P.vivax, P. yoelii (PMID: 11700055)(PMID: 15215371), P. gallinaceum, P. knowlesi, P. bergei and P. chabaudi (PMID:15659334) that conform to the Form2 SECIS element structure. For review of SECIS elements with emphasis on structure (PMID: 11839807)(PMID: 12775843). Other SECIS elements that have conserved sequence and secondary structure are not present in the P falciparum genome, however this does not rule out the presence of more divergent SECIS elements(PMID: 12592000)(PMID: 12520045); MAL8P1.86 epression is upregulated during the trophozoite stage in human erythrocytes (PMID: 12929205);	
PF08_0071	Fe-superoxide dismutase	iron superoxide dismutase activity	response to oxidative stress, superoxide metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.87	hypothetical protein					
PF08_0072	hypothetical protein, conserved					
PF08_0073	hypothetical protein, conserved					
MAL8P1.88	hypothetical protein, conserved					
MAL8P1.90	hypothetical protein					
MAL8P1.91	hypothetical protein, conserved					
MAL8P1.92	ATPase, putative	ATPase activity				
PF08_0074	DNA/RNA-binding protein Alba, putative					
MAL8P1.93	hypothetical protein, conserved				annotation change, aeb, 170105, gene model modified. Resulting addition of 1 amino acid residue on remapping of the gene model onto the new assembly, PHE94	
PF08_0075	60S ribosomal protein L13, putative	structural constituent of ribosome	translation	cytosolic large ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0076	40S ribosomal protein S16, putative	structural constituent of ribosome	translation	cytosolic small ribosomal subunit (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0077	GDP-mannose 4,6-dehydratase, putative	GDP-mannose 4,6-dehydratase activity	GDP-mannose metabolic process, fucose metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0078	hypothetical protein, conserved			apicoplast		
PF08_0079	Translation initiation factor SUI1, putative					
PF08_0080	hypothetical protein, conserved					
PF08_0081	hypothetical protein, conserved				annotation change, aeb 201204,gene model modified. Exon 1 added after remapping. N-terminus now MEYFFYLLKFLC.. , formerly M..	
MAL8P1.94	hypothetical protein			apicoplast		
MAL8P1.95	hypothetical protein, conserved					
MAL8P1.96	CS-domain containing protein, putative					
PF08_0082	hypothetical protein, conserved					
PF08_0083	hypothetical protein, conserved					
MAL8P1.97	hypothetical membrane protein					
MAL8P1.380	hypothetical protein, conserved				annotation change, aeb, 120405, new gene model defined after TBLASTX comparison with P. knolwesi	
PF08_0084	RNA-binding protein (U1 snRNP-like), putative					
PF08_0085	ubiquitin-conjugating enzyme, putative	ubiquitin conjugating enzyme activity	ubiquitin-dependent protein catabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0086	RNA-binding protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0087	importin alpha, putative		NLS-bearing substrate import into nucleus	nuclear pore	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0088	hypothetical protein, conserved					
MAL8P1.98	serine protease, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.99	GTPase, putative				annotation change, aeb, 170105, gene model modified. Exon/intron boundary modified between exon1 and exon2 resulting in the loss of 21 aa from the predicted protein sequence (GYHLVYIYIYIYIYVNKFLFI). Modified on the basis of comparison to regions of conserved synteny in P. falciparum, P. knowlesi and P. yoelii and with the aid of the SNAP gene prediction algorithm	annotation change, aeb, 201204; intron added to exon 1, GYHLVYIYIYIYIYVNKFLFI reomved from the translation
PF08_0089	hypothetical protein, conserved					
MAL8P1.100	hypothetical protein, conserved					
MAL8P1.101	hypothetical protein, conserved			apicoplast		
MAL8P1.102	hypothetical protein, conserved					
PF08_0090	hypothetical protein, conserved					
PF08_0091	hypothetical protein, conserved				GPI-Anchor Signal predicted for PF08_0091 by DGPI v2.04, no cleavage site predicted	
PF08_0092	hypothetical protein, conserved					
MAL8P1.103	hypothetical protein, conserved					
MAL8P1.104	CAF1 family ribonuclease, putative				annotation change, aeb, 170105, gene model modified on remapping onto new assembly, resulting in the change of 1 amino acid in the predicted protein sequence, ASP1777 formerly ALA1777.	<b>attribution</b>:
MAL8P1.105	hypothetical protein, conserved					
PF08_0093	hypothetical protein, conserved					
PF08_0094	cullin-like protein, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.106	hypothetical protein, conserved					
PF08_0095	dihydropteroate synthetase	dihydropteroate synthase activity	dihydrofolate biosynthetic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.107	hypothetical protein, conserved					
PF08_0096	RNA helicase, putative	RNA helicase activity				
MAL8P1.108	protein phosphatase, putative	protein serine/threonine phosphatase activity	protein amino acid dephosphorylation	protein serine/threonine phosphatase complex		
PF08_0097	hypothetical membrane protein, conserved					
MAL8P1.109	Protein phosphatase 2C, putative					
PF08_0098	protein kinase,putative	ATPase activity, coupled to transmembrane movement of substances	transport		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.110	plastid 50S ribosomal protein L33, putative	structural constituent of ribosome	translation	plastid large ribosomal subunit	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0099	Acyl CoA binding protein, putative					
MAL8P1.111	hypothetical protein, conserved					
MAL8P1.112	hypothetical protein, conserved				Plasmodium specific conserved protein	
PF08_0100	ruvB-like DNA helicase, putative	DNA helicase activity			<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.113	Peptidase family C50, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.114	hypothetical protein, conserved					
PF08_0101	hypothetical protein, conserved			apicoplast		
PF08_0102	asparagine-rich antigen Pfa55-14	molecular_function	biological_process	cellular_component	annotation change, aeb, gene model modified on remapping onto new assembly resulting in the change of one amino acid in the predicted protein sequence, THR1174 formerly ALA1174	pfa55-14
PF08_0103	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
PF08_0104	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF08_0105	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	GPI-Anchor Signal predicted for PF08_0105 by DGPI v2.04, no cleavage site predicted	GPI-Anchor Signal predicted for PF08_0105 by DGPI v2.04, no cleavage site predicted
PF08_0106	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	VAR
PF08_0107	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	VAR	<b>attribution</b>:
MAL8P1.121	hypothetical protein, conserved					
MAL8P1.122	hypothetical protein, conserved					
PF08_0108	pepsinogen, putative	pepsin A activity	proteolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.123	hypothetical protein, conserved					
MAL8P1.124	hypothetical protein, conserved			apicoplast		
MAL8P1.125	tyrosyl-tRNA synthetase, putative	tyrosine-tRNA ligase activity	tyrosyl-tRNA aminoacylation		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0109	hypothetical protein, conserved					
MAL8P1.126	serine protease, putative	serine-type peptidase activity	proteolysis		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.127	hypothetical protein, conserved					
MAL8P1.128	proteasome subunit alpha, putative	endopeptidase activity	ubiquitin-dependent protein catabolic process	proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.300	hypothetical protein, conserved				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	Similarity to a hypothetical protein in P. yoelii (Q7RQL9)
PF08_0110	PfRab18, GTPase	GTP binding, GTPase activity	intracellular protein transport, small GTPase mediated signal transduction		rab18	
MAL8P1.130	hypothetical membrane protein, putative					
PF08_0111	RNA helicase, putative					
MAL8P1.131	Gas41 homologue, putative	transcription factor activity	regulation of transcription, DNA-dependent			
PF08_0112	hypothetical protein, conserved			apicoplast		
PF08_0113	vacuolar proton-translocating ATPase subunit A, putative	hydrogen ion transporting ATP synthase activity, rotational mechanism, hydrogen ion transporting ATPase activity, rotational mechanism	hydrogen transport	membrane, membrane fraction, proton-transporting two-sector ATPase complex	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0114	hypothetical protein, conserved					
MAL8P1.132	kinesin-like protein, putative					
PF08_0115	DnaJ protein, putative					
MAL8P1.133	glycosyltransferase family 28 protein, putative					
MAL8P1.134	hypothetical protein, conserved				annotation change, aeb, 170105; gene model modified on the basis of comparison to regions of conserved synteny in P. yoelli and P. knowlesi. The terminal exon modified resulting in a change of the carboxy terminus (..MDCSGCYRNWDIFPHIFV) formerly (VWIVGGVIVIGIFFLIF)	truncated by end of contig; probably splices to MAL8P1.134a
MAL8P1.135	hypothetical membrane protein, conserved					
PF08_0116	hypothetical protein, conserved					
PF08_0117	hypothetical protein, conserved					
MAL8P1.136	hypothetical protein, conserved					
MAL8P1.203	hypothetical protein, conserved				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.202	hypothetical protein, conserved				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	weak similarity to Q6YVI3, Phosphatidic acid phosphate synthase, Oryza sativa
MAL8P1.201	hypothetical protein, conserved				annotation change, aeb, (311004) new sequence data 101004, new sequence data 051104, new gene model	
MAL8P1.200	Acetyltransferase, putative				weak silmilarity to Q7REQ8 in Plasmodium yoelii	annotation change, aeb, 301104; gene model defined
PF08_0118	hypothetical protein, conserved					
PF08_0119	hypothetical protein, conserved					
MAL8P1.137	hypothetical protein, conserved					
MAL8P1.138	hypothetical protein, conserved			apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0120	GTPase-activating protein, putative					
PF08_0121	peptidyl-prolyl cis-trans isomerase precursor	cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity	protein folding		Possibly apicoplast targeted	
PF08_0122	hypothetical protein					
PF08_0123	pseudouridylate synthase, putative					
MAL8P1.139	folate/biopterin transporter					
MAL8P1.140	methionine aminopeptidase, putative	methionyl aminopeptidase activity	proteolysis	apicoplast	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.141	hypothetical protein, conserved					
PF08_0124	hypothetical protein, conserved					
MAL8P1.142	proteasome beta-subunit	endopeptidase activity		proteasome core complex (sensu the Eukaryota research community)	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0125	tubulin gamma chain	structural constituent of cytoskeleton	microtubule cytoskeleton organization and biogenesis	microtubule organizing center	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.143	hypothetical protein, conserved			apicoplast		
MAL8P1.144	AAA family ATPase, putative					
PF08_0126	DNA repair protein rad54, putative	damaged DNA binding	DNA recombination, double-strand break repair via homologous recombination		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.145	hypothetical protein, conserved					
MAL8P1.146	filament assembling protein, putative					
PF08_0127	hypothetical protein, conserved					
PF08_0128	SYF2 splicing factor, putative					
MAL8P1.147	hypothetical protein					
MAL8P1.148	hypothetical protein, conserved				annotation change, aeb, 141204; gene model modified; 5' end of exon 1 modified on remapping. N terminus now MNNQKRYEYWPLEEIILPKKIQNVQFCED..formerly MSNFVKN..	
PF08_0129	protein phosphatase, putative	calcium-dependent protein serine/threonine phosphatase activity, protein serine/threonine phosphatase activity	protein amino acid dephosphorylation			
MAL8P1.149	hypothetical protein, conserved					
MAL8P1.150	hypothetical protein, conserved				weak similarity to hypothetical proteins in Plasmodium berghei PB000487.01.0, 1.3e-22, and Plasmodium chabaudi PC000760.01.0, 1.1e-20	annotation change, aeb, 170105, gene model modified on the basis of comparison of regions of conserved synteny with with P. knowlesi and P. yoelii, and using the SNAP gene prediction algorithm. Resulted in 78 amino acids removed from the predicted protein sequence (YTNMKKTKMINIIMKTMMSSIRLSTQGRIMRRIMRRIMRRIMRRIMRRIMNRIMRR IM NRIMRRIMNRIMKEMN)
MAL8P1.151	inositol phosphatase, putative					
MAL8P1.152	hypothetical protein, conserved					
PF08_0130	wd repeat protein, putative	molecular_function	biological_process	cellular_component	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0131	1-cys peroxidoxin	antioxidant activity, peroxidase activity	response to oxidative stress		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.153	hypothetical protein, conserved					
PF08_0132	glutamate dehydrogenase, putative	glutamate dehydrogenase activity	glutamate metabolic process		<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.154	hypothetical protein, conserved				Weak but extended hit to Pfam amino oxidase domain, PF01593; possible flavin-containing amine oxidase (EC 1.4.3.-)	annotation change, aeb, 170105, gene model modified upon remapping onto new sequence assembly. Due to a abolotion of a stop codon in the remapped sequence PF08_0133 now part of a single orf with MAL8P1.154. The presence or absence of introns in this highly repetative sequence cannot be ruled out
MAL8P1.155	hypothetical protein				annotation change, aeb, 170105, gene model modified when remapped to new sequence assembly. Two amino acids in the differ from the previous sequence, ILE161 was LYS161, LEU162 was MET162	This protein has several short runs of phe and lys which could be indicative of a region of low complexity, suggesting that this may not be a bona fide gene. AEB:04-03-04
MAL8P1.156	mannose-6-phosphate isomerase, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
MAL8P1.157	ubiquitin-like protease 1 homolog,  Ulp1 homolog, putative				<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0134	hypothetical protein, conserved					
PF08_0135	hypothetical protein, conserved					
MAL8P1.158	hypothetical protein					
PF08_0136	hypothetical protein					
PF08_0136b	von willebrand factor a-domain-related protein, putative	cell adhesion molecule binding	cell adhesion			
PF08_tmp2					similar to 5.8s RNA	
MAL8b_28s					similar to 28s rRNA but with insertions	
PF08_0137	hypothetical protein, conserved			apicoplast		
MAL8P1.160	hypothetical protein, conserved in P.falciparum					
MAL8P1.161	hypothetical protein, conserved in P.falciparum			apicoplast		
MAL8P1.162	surface-associated interspersed gene 8.3 (SURFIN8.3)				3D7Surf8.3	
MAL8P1.163	hypothetical protein, conserved in P.falciparum			apicoplast		
PF08_0138	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF08_0139	rifin	molecular_function	antigenic variation	host cell plasma membrane, membrane	RIF	The RIFINs (Repetitively Interspersed Family) are multigene family; of clonally variant antigens displayed on the surface of infected erythrocytes; (IE)(PMID: 3526351)(PMID: 7678099) (PMID:10430943). Northern analysis has; shown maximal expression around 18 - 23 h post red cell invasion which; coincides with the late ring/early pigmented trophozoite stage (PMID:10430943).; They range in size from c.20 - 50 kD (PMID: 10562315). As variant antigens they; have an important role in host-parasite interaction. They are immunogenic in; natural infections and strain-specifically recognised by human immune sera in; immunoprecipitation of surface labelled red blood cell extracts (PMID:10562315).; They have been the focus for a study using phylogenetic-based methods to detect; adaptive evolution at the molecular level (PMID:14711091).; ; Formerly called the rossettins, due to their implicated role in the binding of IE's to; uninfected erythrocytes to form rosettes. Subsequent studies have shown that; despite being present in all clinical isolates they are not always associated; with rosetting. They are often located in proximity to var genes and primarily in; subtelomeric regions. They are are closely related to the STEVOR family, having; the same two exon structure, although they form a more diverse family (PMID:12919858).; The N-terminal half of the sequence contains multiple short; polymorphic and; semiconserved regions and is cysteine-rich. The C-terminal half; is highly polymorphic but ends in a short semiconserved region (PMID: 10430943); Post-translational modification such as glycosylation (N or O-linked) for which numerous; potential sites exist in the amino acid sequences of RIFINs is one possible ; mechanism giving rise to the microheterogenity of this protein family.
PF08_0140	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0141	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	<b>attribution</b>:	Ginsburg, Hagai<br><b>term</b>:
PF08_0142	erythrocyte membrane protein 1 (PfEMP1)	cell adhesion molecule binding	antigenic variation, cell-cell adhesion, cytoadherence to microvasculature, mediated by parasite protein, rosetting	host cell plasma membrane, infected host cell surface knob	PfEMP-1 is expressed on the surface of infected red blood cells (PMID: 14622410), although there is evidence that it is also expressed ; in the early sequestering stages of the gametocytes (PMID: 10200302).; PfEMP-1 is a variant antigen with a major role in evasion of the host immune response and cytoadherence; (PMID: 12919858)(PMID: 10677532)(PMID: 11915943)(PMID: 11260135) and is thus a highly important pathogenicity and virulence factor, and vaccine target(PMID: 11544371)(PMID: 11832958).; It is a ligand for host endothelial epithelial receptor proteins which results in sequestration of infected erythrocytes; in the microvasculature of the brain, placenta and other organs. It also binds uninfected erythrocytes; leading to rossetting (PMID:9230440)(9419207).; ; Transcription of var genes is subject to allelic exclusion. Maturation to trophozoite is concommitant with dominant expression of a single var gene (PMID: 9690477).; VAR gene expression is also modulated by epigenetic mechanisms such as chromatin condensation.; Evidence that regulation involves interaction between two promoters, one upstream and one within the intron PMID: 12832422).; Regulation of var gene expression (PMID: 12791141)(PMID:10717306)(PMID:9736619)(PMID: 12643994); VAR genes are principally located within the subtelomeric regions, although internal clusters exist on chromosome 4,7,8,and 12; and a single internal VAR gene on Chromosome 6.; ; The first exon is polymorphic and encodes the extracellular region of the protein.; The second exon, which encodes the cytoplasmic region is more conserved and contains many acidic residues.; Four domains comprise the majority of PfEMP-1 extracellular sequence: the N-terminal segment (NTS) located at the amino terminus of all PfEMP1, the C2, the cysteine-rich Interdomain Region (CIDR) and the Duffy Binding-like (DBL) domain. CIDR domains fall into three groups (alpha, beta and gamma) bases on sequence similarity and DBL domains into five groups (alpha to epsilon). DBL domain numbering corresponds to its relative location within the protein; DBL-1 being located at the N-terminus (PMID:11071284).; Characterisation of domain organisation reveals 18 types (PMID: 12603733) (PMID:7624377)(PMID: 11872399). Domain organisation is not random, with certain domain-pairings being preferentially observed e.g. DBL (alpha)CIDR(alpha): DBL(delta)CIDR(beta) and DBL(beta)C2.; Distinct domains are resposible for specific binding to host receptors:; DBL-1 to Blood group A antigen, CR1, GAG's; CIDR to CD36 and IgM; DBL-3 to CD31, DBL-4 to CSA.; Phylogenetic analysis of VAR sequences (PMID: 14565852).; Three characterised uptsream untranscribed regions , upsA (11),upsB (35) and upsC (13), with preferential association for VAR genes (PMID:12791141)(PMID: 12368864):; upsB and upsB with telomeric VAR genes; upsC with internal VAR genes; Nearly all telomeric VAR genes have AT-rich region c. 2kb upstream of characterised by poly(A) tracts and one or more occurence of 'GGATCTAG'.; Also three families of sequences of downstream associated sequences; For reviews (PMID: 11544371)(PMID:14747137)(PMID: 11872399)	VAR
